KEGG   Propionibacterium acnes 266: PAZ_c11810Help
Entry
PAZ_c11810        CDS       T01971                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
paw  Propionibacterium acnes 266
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAZ_c11810 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAZ_c11810 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAZ_c11810 (trpA)
Enzymes [BR:paw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAZ_c11810 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1204529..1205026
Genome map
AA seq 165 aa AA seqDB search
MTGSASVYLRAHQENRPALVGYFPVGHPSVPHSIDAMKALTTGTTGTGVDLVVIGMPYSD
PMMDGTVIQHVTTGALERGVRTRDTLLATEAVAGTGTPCVIMTYWNLVEHYGVDAYARDL
ASAGGSGLTTPDEAEDRGDSVTVGIDRMCAIVDDLAAGVRRAERQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtagcgccagtgtctacctcagggcccaccaagagaaccgcccggccctcgtc
ggttacttcccggtgggacacccgtcagttcctcactcgatcgatgctatgaaggcactg
actacgggcactactgggaccggtgtcgacctcgtcgtgatcggaatgccttactccgac
ccgatgatggacggcaccgtcattcagcacgtcactaccggggctctagagcgcggggta
cgcactcgcgacaccctattggccacagaggccgtggccgggaccggaactccgtgcgtg
attatgacctattggaaccttgtcgagcactacggtgtcgacgcttatgctcgcgatctg
gcatccgcgggtggctcagggctcaccacccccgatgaggctgaggatcggggggactca
gtgacggtaggaattgaccggatgtgcgccatcgtcgacgacctggcggccggagtacgg
cgggcggaacgccagtga

DBGET integrated database retrieval system