KEGG   Propionibacterium acnes 266: PAZ_c12010Help
Entry
PAZ_c12010        CDS       T01971                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
paw  Propionibacterium acnes 266
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:paw01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:paw00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1229613..1230932
Genome map
AA seq 439 aa AA seqDB search
MLRIVDVTSETTDDLRCAVPRADFDVDAAMAAVIPVCSAVRDRGVEALREYSEKFDHVVP
EHLRVPVEALATAAANLDGTLRRAFSESIRRRRHVCQEAEVEASSQPVEVAGGARVSQRI
VPVGRVGLYVPGGFAPLASSVIMNVVPAQEAGVSSIAVASPPQAEFGGLPHPSILALCHL
LGVNEVYAVGGAQAIAMFAYGVEGSDEADSCPRVDMVTGPGNIYVVAAKRCLRGTVGIDS
EAGPTEIAILADKTADPRHIAADLMSQAEHDTLAAAVLVTDSTTLAEAVQRELAPMVSAT
LHSERIRTSLTSKQSAIVMVRDIDQGLEVVNAYAAEHLEIQTADAAAVAARVRNAGAIFV
GPWAPVSLGDYSAGSTHVLPTAGAACHSSGLSVRSFMRAVHVIDYTEDALLELADSVEAF
ALAENLPGHANAITVRRSR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagaatcgtcgatgtgaccagtgagaccactgacgacctgcgttgcgccgtgcct
cgcgcggacttcgatgtcgatgccgccatggcggccgtcatccccgtctgctctgcggtg
agggatcgtggcgttgaggcgctacgtgagtacagcgagaaattcgaccatgtggttccc
gagcatctgcgcgttccggtcgaggctctcgccacggcagctgcgaacctcgacggcacc
ttgcgtcgggctttcagcgaatctattcgacgtcgtcgtcacgtatgtcaggaagctgag
gtggaggcctcttcccaaccggttgaggtggcaggcggcgcgcgggtgagccagcgcatc
gtcccggtcgggcgtgtaggcctttacgttccgggtgggttcgctccgctggcatcgtcg
gtcatcatgaacgtcgttcctgcgcaggaggccggtgtttcgtctatcgctgtagcatct
ccgccccaggcggagtttggtgggttgccgcacccgagcatcttggcgctgtgtcatcta
ctgggtgtcaatgaggtctacgccgtcggcggtgcccaggcgatcgccatgttcgcttac
ggcgttgagggctccgacgaggcagattcctgtccgcgcgtcgacatggttacgggtcca
ggcaacatctacgtagtcgcggcaaagcgctgcctgcgtggcaccgtcggcatcgattcg
gaggctgggcccaccgaaatcgccatcctggccgataagactgccgacccgcgtcacatt
gctgctgatcttatgagccaggctgagcatgacacgctggctgccgcagtgcttgtcaca
gactcgaccacactggccgaagctgtgcaacgagaacttgccccgatggtcagtgccacg
ttacattccgagcgcattcgcacctcgctgacatccaagcagtcggccatcgtcatggta
cgtgatattgatcagggcctcgaagtggtcaatgcgtatgccgccgagcatctcgagatc
cagacggctgatgctgccgcagtcgctgctcgggtccggaacgctggcgccattttcgtc
ggcccgtgggcgcctgtctctcttggggactactcagccggatccactcacgtccttccc
acggcaggagcagcctgccactcgtctggtctgtcggtgcgttccttcatgcgcgccgtc
cacgtcatcgattacaccgaggatgccctacttgagctggccgattccgttgaggctttt
gccttggcggagaacttgcccggccatgccaatgccatcactgtgaggaggtcacgttga

DBGET integrated database retrieval system