KEGG   Propionibacterium acnes 266: PAZ_c12080Help
Entry
PAZ_c12080        CDS       T01971                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
paw  Propionibacterium acnes 266
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:paw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1235630..1236235
Genome map
AA seq 201 aa AA seqDB search
MISHFSGMVSAAGPTWVVLDNHGVGIKVLCPPATAASARINQDMSLHTSLVVREESLTLY
GFVEADDRDAFELVQTASGVGPKLAAAIMSVLDAAQLATAITEEDDATLCRVPGIGRKGA
AKMILELKDKVAALTPRGASVSGATHVVAPWREQVAEGLVGLGWSAKDAEKAVDKVAALK
EADPAMTIGNLMRAALRSLAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccatttttccggcatggttagtgccgctggcccgacgtgggtcgtccttgac
aatcatggggttggtatcaaggtgctgtgccctcctgccacagctgcgagtgctcgcatc
aaccaagatatgtccctgcacacctccctggttgtgagagaggagtccctgactctttac
gggttcgtcgaagctgatgatcgcgatgcttttgagctggtgcaaaccgcgtcgggagtc
ggtcccaaattagctgcagcgattatgagtgtccttgatgctgctcagctagccacggcg
ataaccgaagaagatgacgcaactctatgccgcgttcccggaattggtcgcaagggtgcg
gcgaaaatgatcctggagctcaaggacaaggtcgcagcccttaccccacgtggagcttcg
gtgagcggagcgacccatgtggtcgcaccgtggcgggaacaggtggcggaagggctggtc
ggcttgggctggtcggctaaagacgcggagaaggccgtcgacaaggtggctgctctcaag
gaagccgatccagctatgaccatcggcaacctcatgcgagcggcattgcgtagtttggcg
cggtga

DBGET integrated database retrieval system