KEGG   Propionibacterium acnes 266: PAZ_c13070Help
Entry
PAZ_c13070        CDS       T01971                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
paw  Propionibacterium acnes 266
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAZ_c13070 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAZ_c13070 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAZ_c13070 (thrC)
Enzymes [BR:paw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PAZ_c13070 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1336565..1337635)
Genome map
AA seq 356 aa AA seqDB search
MSQQNRLFGVIETYRDRLPMDGIDQIVTLGEGATPLVPAPRLGAELDATVWVKVEGANPT
GSFKDRGMTMAMTKALADGSKAVVCASTGNTSASASAYASRAGMTPVVLLPQGKIAAGKL
AQAVVHGGRIIQILGNFDDCLRIARELAENFPVSLVNSINPYRIEGQKTAAFEVVDVLGD
APDIHALPVGNAGNITAYWKGYREYVADGPASHTPRMFGFQAAGAAPLVLGHDVNDPETV
ATAIRIGRPASGKLALAARDESEGLIDAVTDEQILDAQTFLAAREGIFVEPASAVGVAGL
FKLKSEGRLDPGLRIVVTVTGNGLKDIDTALSRTTLSTEAVEASTDQVAALLDFCS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcagaatcgtctcttcggcgtgattgagacctatcgagaccgtctccctatg
gacggaattgaccagatcgtgacgttgggggagggggcgaccccgttggtgcctgcccca
cgattgggcgccgagcttgacgcgacggtatgggttaaagttgaaggggccaatccgacc
ggatcgttcaaggatcgtggcatgacgatggccatgacgaaagcccttgccgacggctcg
aaagccgtggtgtgtgcctctaccggtaatacctctgcctcggcatcggcttacgcctcc
cgagccggcatgactccggtcgtgctccttccccagggcaagattgcagctggcaaactc
gcccaggctgttgtccatggcggtcgaatcatccagattctcggcaacttcgacgattgc
ctgcgtattgcccgcgagctggccgagaatttcccggtctccctggtgaactcgatcaat
ccgtaccgcatcgagggacagaaaactgctgcctttgaggtcgttgacgttcttggtgac
gctcctgatatccacgctcttccggtgggcaacgcaggcaatatcaccgcctattggaag
ggttaccgcgagtacgtagcggacggtcctgccagccacacgccgcggatgttcggattc
caagccgctggcgcagcccccctggtgctgggccacgacgttaatgacccggaaacggta
gccaccgctattcgtatcggtcgtccggcctccggcaagctggcgttggccgctcgagac
gagtcggaggggctcatcgacgctgtcacggacgagcaaattcttgacgcccagactttc
ctagctgctcgagagggcatttttgttgagccggcatcagcagtcggagtggcaggtttg
ttcaagttgaagtccgagggacgcctggatcctggactgcgcatcgtcgtcacggtaact
ggaaacggtctgaaggacattgacactgcattgagtcgcactaccttgtcaaccgaggct
gtggaagcttcgactgaccaggttgccgctttgttggacttctgttcctga

DBGET integrated database retrieval system