KEGG   Propionibacterium acnes 266: PAZ_c13780Help
Entry
PAZ_c13780        CDS       T01971                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
paw  Propionibacterium acnes 266
Pathway
paw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:paw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PAZ_c13780 (recD)
Enzymes [BR:paw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PAZ_c13780 (recD)
DNA repair and recombination proteins [BR:paw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PAZ_c13780 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD DUF2075 AAA_25 AAA_22 PhoH T2SSE NACHT UvrD_C UvrD-helicase AAA CbiA AAA_28 FtsK_SpoIIIE AAA_29
Motif
Other DBs
NCBI-ProteinID: AEE72545
Position
1405338..1407128
Genome map
AA seq 596 aa AA seqDB search
MCRIGGESNCDVSLAIALSCRELRRGSVFWDPHEIANVVRQQILDPAIPDIETSDQAALF
AELEWPPPGEWLSTLEASPVIAGRDDPLNRLPARLDDGLVYLEKYWQAEHDVARDLATLA
ADPPSQGPVSADDVVSSISNALAASGIMLDPAQADAAIAAIMHRVSVLAGGPGTGKTTTV
CALLAALQQADPHLGAVALAAPSGKAAARLRDSVSQVSERMPDDLKPIVADATTVHSLLK
WQGPGTSFGYDEQHKLPFGVVVVDEASMLSLPLAASLLSAIGPQTRLILVGDPGQLVSVD
AGSVLADIVSSADALQAQLPVTILTCNHRSRGDIARLSEAVREGDKSTALDVLATAAGVT
HDSPSPDSIATISGRRSITWIDADPASITMADLPAVAEVIARTGARMLELAQASADAAAL
KLVDAHRLLCAHREGPYGVDEWSQRMVTVLSDVLPGVGQGRWVLGETAIVTHNLAQLGVN
NGDCGVIVETRPVPTIALPGPGGVPRRLPCSLIPSLQPLQAMTIHKAQGSQFTDVTVVLP
PPDSPLLSRELLYTAITRAREHLTVVGTRESVERAIDRANDRRSGIQRRWEESRTS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
gtgtgccgcatcggtggcgagagcaactgcgatgtcagcctcgccatcgctttatcatgc
cgtgagcttcggcgcgggtccgtgttctgggacccacatgaaatcgcaaacgtcgtccgc
cagcaaatccttgatccggcaattccagacatcgaaaccagcgaccaggcagccctattc
gcggaattggaatggccacctccaggcgagtggctgtccacgctagaggccagtcccgtc
attgctggccgtgatgatccgctcaaccggttgccggctcggcttgatgatggcctggtc
tacctagagaaatattggcaagctgagcatgatgtcgcccgcgatctcgctaccctcgct
gcggatccgccaagccaaggcccagtgtcggccgacgatgttgtttccagcatcagtaat
gccttagcagcatccggaattatgttggatccagctcaagctgatgctgccatcgccgca
attatgcaccgagttagtgtgcttgcaggtggccccggaaccggcaagacaactacggta
tgcgccctcctagctgccttgcaacaggctgaccctcatcttggagccgtggcccttgcg
gctcccagcggcaaagcagcggcacgcttgcgtgactcagtttcgcaagtttcagagcga
atgcccgatgacctgaaaccgattgttgctgacgcaactaccgtccactcactgctgaaa
tggcaggggccgggaacctcattcggatatgacgagcaacacaagcttccgttcggagtc
gtcgtcgttgacgaagcatcaatgctttctctgcctctggccgctagcctcctctctgca
atcgggcctcaaactcgtctaattctcgtcggggacccagggcagcttgtctcggtggac
gccggtagtgtcctggccgacatcgtttcgtcggctgatgccctccaagcgcagcttcct
gtcacgatcctcacctgtaaccaccgctcgagaggagatatcgcacggctgtcggaggcg
gtacgcgagggagacaagagcactgcgttggacgtattggcgacagctgctggcgtgaca
catgactctccttcccccgatagcatcgcgacgatcagtggtcgtcgcagtattacgtgg
atcgacgctgacccggcgagtatcaccatggccgaccttccggcggtcgcggaggtgatc
gcacgcaccggggcaagaatgcttgagcttgctcaggctagtgccgacgctgctgctctc
aaactcgtcgatgcccaccggttgttgtgcgctcaccgagaggggccatacggggtagac
gagtggtctcagcgcatggttactgtactttcagatgtgttgcctggtgttggccaaggc
cggtgggttctcggcgaaactgcaatagtaacgcataacctcgcacaattgggagtcaat
aacggcgattgcggggtcatcgttgaaacaaggcccgtccccacgatagctctaccggga
cccggtggagtccccagacggttgccctgttccctcatcccatcgctgcaacccttacag
gcgatgacgattcacaaagcgcagggcagccaattcacggacgtaacggtggtcctgcca
ccacccgactcgcccctcctctctcgtgagttgctctataccgccatcacgcgtgcacgt
gaacacctcactgtggtgggcacaagggagtctgtggagagggcgattgaccgggctaat
gatcgacgttctgggattcagcgccggtgggaagaaagtcgcacttcctga

DBGET integrated database retrieval system