KEGG   Propionibacterium acnes 266: PAZ_c13780Help
Entry
PAZ_c13780        CDS       T01971                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
paw  Propionibacterium acnes 266
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:paw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PAZ_c13780 (recD)
Enzymes [BR:paw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PAZ_c13780 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1405338..1407128
Genome map
AA seq 596 aa AA seqDB search
MCRIGGESNCDVSLAIALSCRELRRGSVFWDPHEIANVVRQQILDPAIPDIETSDQAALF
AELEWPPPGEWLSTLEASPVIAGRDDPLNRLPARLDDGLVYLEKYWQAEHDVARDLATLA
ADPPSQGPVSADDVVSSISNALAASGIMLDPAQADAAIAAIMHRVSVLAGGPGTGKTTTV
CALLAALQQADPHLGAVALAAPSGKAAARLRDSVSQVSERMPDDLKPIVADATTVHSLLK
WQGPGTSFGYDEQHKLPFGVVVVDEASMLSLPLAASLLSAIGPQTRLILVGDPGQLVSVD
AGSVLADIVSSADALQAQLPVTILTCNHRSRGDIARLSEAVREGDKSTALDVLATAAGVT
HDSPSPDSIATISGRRSITWIDADPASITMADLPAVAEVIARTGARMLELAQASADAAAL
KLVDAHRLLCAHREGPYGVDEWSQRMVTVLSDVLPGVGQGRWVLGETAIVTHNLAQLGVN
NGDCGVIVETRPVPTIALPGPGGVPRRLPCSLIPSLQPLQAMTIHKAQGSQFTDVTVVLP
PPDSPLLSRELLYTAITRAREHLTVVGTRESVERAIDRANDRRSGIQRRWEESRTS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
gtgtgccgcatcggtggcgagagcaactgcgatgtcagcctcgccatcgctttatcatgc
cgtgagcttcggcgcgggtccgtgttctgggacccacatgaaatcgcaaacgtcgtccgc
cagcaaatccttgatccggcaattccagacatcgaaaccagcgaccaggcagccctattc
gcggaattggaatggccacctccaggcgagtggctgtccacgctagaggccagtcccgtc
attgctggccgtgatgatccgctcaaccggttgccggctcggcttgatgatggcctggtc
tacctagagaaatattggcaagctgagcatgatgtcgcccgcgatctcgctaccctcgct
gcggatccgccaagccaaggcccagtgtcggccgacgatgttgtttccagcatcagtaat
gccttagcagcatccggaattatgttggatccagctcaagctgatgctgccatcgccgca
attatgcaccgagttagtgtgcttgcaggtggccccggaaccggcaagacaactacggta
tgcgccctcctagctgccttgcaacaggctgaccctcatcttggagccgtggcccttgcg
gctcccagcggcaaagcagcggcacgcttgcgtgactcagtttcgcaagtttcagagcga
atgcccgatgacctgaaaccgattgttgctgacgcaactaccgtccactcactgctgaaa
tggcaggggccgggaacctcattcggatatgacgagcaacacaagcttccgttcggagtc
gtcgtcgttgacgaagcatcaatgctttctctgcctctggccgctagcctcctctctgca
atcgggcctcaaactcgtctaattctcgtcggggacccagggcagcttgtctcggtggac
gccggtagtgtcctggccgacatcgtttcgtcggctgatgccctccaagcgcagcttcct
gtcacgatcctcacctgtaaccaccgctcgagaggagatatcgcacggctgtcggaggcg
gtacgcgagggagacaagagcactgcgttggacgtattggcgacagctgctggcgtgaca
catgactctccttcccccgatagcatcgcgacgatcagtggtcgtcgcagtattacgtgg
atcgacgctgacccggcgagtatcaccatggccgaccttccggcggtcgcggaggtgatc
gcacgcaccggggcaagaatgcttgagcttgctcaggctagtgccgacgctgctgctctc
aaactcgtcgatgcccaccggttgttgtgcgctcaccgagaggggccatacggggtagac
gagtggtctcagcgcatggttactgtactttcagatgtgttgcctggtgttggccaaggc
cggtgggttctcggcgaaactgcaatagtaacgcataacctcgcacaattgggagtcaat
aacggcgattgcggggtcatcgttgaaacaaggcccgtccccacgatagctctaccggga
cccggtggagtccccagacggttgccctgttccctcatcccatcgctgcaacccttacag
gcgatgacgattcacaaagcgcagggcagccaattcacggacgtaacggtggtcctgcca
ccacccgactcgcccctcctctctcgtgagttgctctataccgccatcacgcgtgcacgt
gaacacctcactgtggtgggcacaagggagtctgtggagagggcgattgaccgggctaat
gatcgacgttctgggattcagcgccggtgggaagaaagtcgcacttcctga

DBGET integrated database retrieval system