KEGG   Propionibacterium acnes 266: PAZ_c17530Help
Entry
PAZ_c17530        CDS       T01971                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
paw  Propionibacterium acnes 266
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:paw00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1788062..1790170)
Genome map
AA seq 702 aa AA seqDB search
MSLTDPHLTTLADHFGIARDYYDWKGQHTEVGKATVIAVLDGLGIDASTPERAERACHEV
TNRKWRRVLPGIVVLREGQEGRVDVHVNAGEWVEVHVVCEDGQRRECWQVDNWNPDRHVD
DRWIGEATFGIPGDLPLGYHTIVATTADHRATSTLVVSPNWLGLPRSMGSSRVWGHAVQL
YSTRSRASWGMGDFSDLADLSTWAATQGADYVLVNPLHASQVVSPIEPSPYLPCSRLFLN
PLYVRPEIIPEYADLDVYVRSQARSARAQAAADAEAIDRDRSWNAKLPVLEAVHALGLEG
SRELSYQAFRRLCGTRLEDLATWCALTEVYGKDWRTWPEEYQRPSNRAVSEFVRAHEERV
DFFMWLQWIADQQLSAAQSAGRDAGMSLGLMCDMAVGVSGAGADAWMLGKLFADGVCVGS
PPDAFNQAGQEWGQPPMRPDILANLAYRPFRDMVRAALRHAGGIRIDHILGLFRLWWVPV
GLGPRMGTYIRYDHEAMVGILALEAHRAGALVVGEDLGTVEPWVRAYLRERGIMGTSVLW
FENGENGNPLPPEQWREYAMSSVTTHDLPPTTGYLAGDHVEVRHELGLLTESLEHERAEV
ARQTATWIAILRERGVLVGDDPSEEDIVLAMHRMLTRTPSKVLNATLTDAVGDRRTQNLP
GTTNEYPNWRVPLSHPDGSPMWLDEVFTDERAARLSHVMNEK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgacagatccccacctgacgaccctggccgatcatttcggcatcgctcgtgat
tattacgactggaagggccagcacaccgaggtcgggaaggcgactgttattgctgtcctt
gacggtttgggaattgacgcgtcgactccggaacgtgccgaacgcgcgtgccacgaggtg
actaaccggaagtggcgtcgagtgttgcccggaatcgtggtcctacgtgagggtcaagag
gggcgggttgacgttcacgttaatgcaggggagtgggtggaggttcacgtcgtctgcgag
gacgggcaacgccgcgagtgttggcaggtcgacaattggaaccccgatcgccacgtggac
gatcgttggattggtgaggcgaccttcggtatccctggcgatctgccgttgggctaccac
acgatcgtcgcgacgactgcggaccatcgcgcgacctctacgcttgtagtctccccgaac
tggctcggccttcctcgttcgatgggttcgtctcgggtctggggccatgccgtgcagttg
tattcgactcgctcccgcgcctcctggggaatgggtgatttttccgacctggcggacctg
tctacctgggcggccacccagggtgctgactacgtgctcgtgaatccgctgcatgccagc
caggttgtctcccccatcgagccgtcgccgtatttgccttgcagccgtctcttcctgaac
ccgctgtatgtgcgccccgagatcatcccggagtatgccgacctcgacgtctatgtgcgt
tcccaggcacgctcggcccgggctcaagcagcggccgatgctgaggcaatcgatcgagat
cgttcctggaacgccaaactgccagtgctagaagccgtccatgccctcggtctggaggga
tcgagggaattgtcctaccaggcattccgccggctgtgtggtactcgtttagaagatctc
gcgacgtggtgtgcactgacggaggtatacggcaaagattggcgcacctggcccgaggag
tatcagcgccccagcaaccgtgccgtctcagagttcgtgcgagctcacgaggaacgcgtc
gattttttcatgtggctgcagtggattgctgaccaacagctttcggcggcccaatctgcc
ggacgtgacgccgggatgtcgctgggacttatgtgcgatatggccgtgggtgtttccggt
gccggagccgatgcgtggatgctcgggaagctctttgctgacggtgtctgcgtcgggtcg
ccgcctgatgcttttaatcaggctggacaggagtggggacagcctccgatgcgtcccgac
atcctcgccaatctggcatatcggcctttccgcgacatggtgcgcgccgctttgcgtcac
gccggtggcatccgcatcgaccatattctcggcctgttccggctgtggtgggtacccgtc
ggtctcggcccgcgtatgggtacttacatacggtacgaccacgaagccatggttggtatt
ttggcgctggaggcgcaccgggctggcgcccttgtcgtgggcgaggacctgggaacggta
gagccgtgggtgcgcgcctacttgcgtgagcgcggcatcatgggcacctcggtcctgtgg
ttcgagaatggtgagaatggcaatccgctgcctcctgagcagtggcgcgagtacgccatg
agttcggtcactacccatgatttacctcccactactgggtatctggctggtgatcacgtc
gaggtgcgtcatgagctgggactactcactgaatctctcgagcacgagcgcgctgaggtg
gctcgtcagactgccacctggatcgccatcctgcgtgagcgtggcgtgttggtgggggat
gacccctccgaagaggacatcgtgttagcgatgcatcgcatgcttacccgcaccccgtca
aaggtgctcaatgccaccctgactgacgcggtgggagatcgtcgcactcaaaacttgccg
ggtaccacgaatgaatacccaaactggcgggtccctctcagccatccggatggttccccg
atgtggctggatgaggtatttactgacgagcgggctgcgcgactgtctcacgtcatgaac
gagaagtga

DBGET integrated database retrieval system