KEGG   Propionibacterium acnes 266: PAZ_c18960Help
Entry
PAZ_c18960        CDS       T01971                                 

Gene name
lacZ2
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
paw  Propionibacterium acnes 266
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PAZ_c18960 (lacZ2)
Enzymes [BR:paw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PAZ_c18960 (lacZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1936864..1937724
Genome map
AA seq 286 aa AA seqDB search
MTEPSMRKAEHRHSLSRTMAALTAVACASTSLAATPTTAAATSPSQTPKAMSSAPYIFPG
NDGKAHKVAWDKHSFTIDGTRLSIWFGELHYWRLPSQQAWRDVMHKARANGFNAISLYFF
WGLHQESADGKFDFSGIKDIDKLLTIAEEEGLYVIARPGPYINAEISMGGLPATMSNQPG
PLRGTANLARSKQWLHAFDVIARKHQVTTGGGSLLMYQVENELLDESSDRSAFLKALTSY
VRADGITVPLFTNDYSMAGHRPPLTVIQTRSGTPAGRHPLRPIRIP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccgtccatgcgcaaagccgagcatcgccattccttatcccggacgatggcc
gcactgaccgcggtcgcctgtgcctcaacctcccttgccgccacacctaccacagctgcg
gcaacgtcaccgtcacagacaccgaaggcgatgtcatcggcgccttatatcttcccgggc
aacgacggaaaagcccacaaagtcgcttgggacaagcactcgttcaccatcgacggcacc
cggttgtcgatctggttcggggaactgcactactggcgcctcccctcccagcaggcgtgg
cgcgacgtcatgcacaaagctcgcgcgaacggtttcaacgccatctcgttgtacttcttc
tggggcctgcaccaagaatccgctgacggcaagttcgacttctccggcattaaagacatc
gacaaactgctcaccatcgccgaagaggagggtctgtacgtcatcgcccgacccggcccc
tacatcaacgccgaaatctccatgggcggcctccccgccaccatgagcaaccagcccggg
cctctgcgtggcactgcgaacctggcgcgctcaaaacaatggctgcatgcattcgacgtc
atcgcccgcaagcaccaagtgacgaccggcggcggttccctgctcatgtaccaggtggag
aacgagctgctcgacgagagttccgaccgatccgccttcctcaaggcgctgacgagctac
gtccgggccgacggcatcaccgtcccgctgttcaccaacgactactcaatggccgggcat
cggccgccgttgacggtaatccaaacacgttctggcactcccgctgggaggcacccgttg
cgacctatccgcataccttga

DBGET integrated database retrieval system