KEGG   Propionibacterium acnes 266: PAZ_c19760Help
Entry
PAZ_c19760        CDS       T01971                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
paw  Propionibacterium acnes 266
Pathway
paw00071  Fatty acid degradation
paw00280  Valine, leucine and isoleucine degradation
paw00310  Lysine degradation
paw00360  Phenylalanine metabolism
paw00380  Tryptophan metabolism
paw00410  beta-Alanine metabolism
paw00627  Aminobenzoate degradation
paw00640  Propanoate metabolism
paw00650  Butanoate metabolism
paw00903  Limonene and pinene degradation
paw01100  Metabolic pathways
paw01110  Biosynthesis of secondary metabolites
paw01120  Microbial metabolism in diverse environments
paw01130  Biosynthesis of antibiotics
paw01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PAZ_c19760
   00650 Butanoate metabolism
    PAZ_c19760
  Lipid metabolism
   00071 Fatty acid degradation
    PAZ_c19760
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAZ_c19760
   00310 Lysine degradation
    PAZ_c19760
   00360 Phenylalanine metabolism
    PAZ_c19760
   00380 Tryptophan metabolism
    PAZ_c19760
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAZ_c19760
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PAZ_c19760
   00281 Geraniol degradation
    PAZ_c19760
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PAZ_c19760
   00627 Aminobenzoate degradation
    PAZ_c19760
   00930 Caprolactam degradation
    PAZ_c19760
Enzymes [BR:paw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PAZ_c19760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 Abhydrolase_6
Motif
Other DBs
NCBI-ProteinID: AEE73106
Position
complement(2006906..2007832)
Genome map
AA seq 308 aa AA seqDB search
MKISGTDDVTIILDRPRAINSLSGEMLGAIGEAVKGSPRSIDLSGAGERGYCSGADIREL
RSLVLKDPEAAGDWLDGEYDVDAAIAEVHSGTAHLHGISMGGGLGLALRLKRVEARDDLV
LAMPETGIGLWPDVGACFELSRAPRLVGRHIAMTGAFIDAASALWAGLVDEVVDADGEPV
DVDPVACQLARDAVWIQECYDTDDPVEVCRRLADRPEPAARKTAEHIATRCPLSVAVALA
AVVRAESASGLGEVLETDRALGRSFMRNSDFCEGVRAQLVDKDRNPHWSHESVADVPARQ
VEGMFDPS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcagcggtaccgacgatgtcacgatcatcttggaccgtccccgagcgatcaac
tcgttatctggtgagatgctgggggctattggggaggccgtcaagggatcgccgcgcagc
atcgatctatccggtgcgggagagcgcggctactgttcgggagctgacattcgcgagctc
agatcgttggtattaaaggatcccgaggccgctggtgactggttggatggtgagtacgac
gttgacgctgccattgctgaggtgcattcggggaccgcgcatctgcatggcatttccatg
ggcggcgggcttgggttggcactgcgccttaagcgggtcgaggctcgcgacgacctcgtc
cttgcgatgccggaaacgggtattggtctatggcctgacgtgggtgcgtgtttcgagctc
tctcgggccccgcgccttgtcggccgccatatagccatgaccggggccttcatcgatgcg
gcttcggcgctgtgggccggtttggtagatgaggtcgtcgacgccgacggcgagcccgtt
gacgtcgatccggtcgcttgtcagttggcgcgcgatgcggtgtggattcaggagtgttat
gacactgatgatcccgtcgaggtgtgtcgtcgattggctgatcgtcccgagccggccgcg
cgtaagacggctgagcacatcgcgacgcgctgtccgttgtcggtagctgtcgcattggcc
gctgtcgtgagggctgaatccgcgtcaggtcttggcgaggtgttggagactgatcgtgct
ctggggcggtcctttatgcgcaattcggacttttgtgagggggtgcgcgcccagctggtc
gacaaggaccgcaacccgcattggtcccacgagagcgtggctgacgtgcccgctcgtcag
gttgaggggatgttcgacccgtcctga

DBGET integrated database retrieval system