KEGG   Propionibacterium acnes 266: PAZ_c19760Help
Entry
PAZ_c19760        CDS       T01971                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
paw  Propionibacterium acnes 266
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PAZ_c19760
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PAZ_c19760
   00650 Butanoate metabolism
    PAZ_c19760
  Lipid metabolism
   00071 Fatty acid degradation
    PAZ_c19760
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAZ_c19760
   00310 Lysine degradation
    PAZ_c19760
   00360 Phenylalanine metabolism
    PAZ_c19760
   00380 Tryptophan metabolism
    PAZ_c19760
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAZ_c19760
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PAZ_c19760
   00281 Geraniol degradation
    PAZ_c19760
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PAZ_c19760
   00627 Aminobenzoate degradation
    PAZ_c19760
   00930 Caprolactam degradation
    PAZ_c19760
Enzymes [BR:paw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PAZ_c19760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2006906..2007832)
Genome map
AA seq 308 aa AA seqDB search
MKISGTDDVTIILDRPRAINSLSGEMLGAIGEAVKGSPRSIDLSGAGERGYCSGADIREL
RSLVLKDPEAAGDWLDGEYDVDAAIAEVHSGTAHLHGISMGGGLGLALRLKRVEARDDLV
LAMPETGIGLWPDVGACFELSRAPRLVGRHIAMTGAFIDAASALWAGLVDEVVDADGEPV
DVDPVACQLARDAVWIQECYDTDDPVEVCRRLADRPEPAARKTAEHIATRCPLSVAVALA
AVVRAESASGLGEVLETDRALGRSFMRNSDFCEGVRAQLVDKDRNPHWSHESVADVPARQ
VEGMFDPS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcagcggtaccgacgatgtcacgatcatcttggaccgtccccgagcgatcaac
tcgttatctggtgagatgctgggggctattggggaggccgtcaagggatcgccgcgcagc
atcgatctatccggtgcgggagagcgcggctactgttcgggagctgacattcgcgagctc
agatcgttggtattaaaggatcccgaggccgctggtgactggttggatggtgagtacgac
gttgacgctgccattgctgaggtgcattcggggaccgcgcatctgcatggcatttccatg
ggcggcgggcttgggttggcactgcgccttaagcgggtcgaggctcgcgacgacctcgtc
cttgcgatgccggaaacgggtattggtctatggcctgacgtgggtgcgtgtttcgagctc
tctcgggccccgcgccttgtcggccgccatatagccatgaccggggccttcatcgatgcg
gcttcggcgctgtgggccggtttggtagatgaggtcgtcgacgccgacggcgagcccgtt
gacgtcgatccggtcgcttgtcagttggcgcgcgatgcggtgtggattcaggagtgttat
gacactgatgatcccgtcgaggtgtgtcgtcgattggctgatcgtcccgagccggccgcg
cgtaagacggctgagcacatcgcgacgcgctgtccgttgtcggtagctgtcgcattggcc
gctgtcgtgagggctgaatccgcgtcaggtcttggcgaggtgttggagactgatcgtgct
ctggggcggtcctttatgcgcaattcggacttttgtgagggggtgcgcgcccagctggtc
gacaaggaccgcaacccgcattggtcccacgagagcgtggctgacgtgcccgctcgtcag
gttgaggggatgttcgacccgtcctga

DBGET integrated database retrieval system