KEGG   Propionibacterium acnes 266: PAZ_c21660Help
Entry
PAZ_c21660        CDS       T01971                                 

Gene name
hemY2
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
paw  Propionibacterium acnes 266
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAZ_c21660 (hemY2)
Enzymes [BR:paw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PAZ_c21660 (hemY2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2204506..2205918
Genome map
AA seq 470 aa AA seqDB search
MVPERAYPQTVSKTVAVIGAGMTGLAAAHHLHSHGCRPVVLEAGQGVGGQVRSRRLGSDV
VDMGPEAVPLRAPGVAALVAELGLTDSMRHPVPGRVLLSSRRGVVEMPSGVTPVGPTKFL
PTIASRILSPAGLLRAGLEPFNAHPHLDDVSVGQFIAERFGDEVSRAVVDPLLGGIHAAD
LNTFSLAVAAPALEQTVRNGDSIVAGTLKRNAAGRWSQLRHHSQRSGPRTPATATWKHGL
MMLPEALARELTIHTNTRARGIRQVGHEWVVDVTGPHGVGSVAVDDVIIATPARVAGALL
ATACPRASELLSQCESTTVATLVMQADLTDHPIATAQTWFIGSAWSALVRQVTNLSTTWH
LAKPTFRIAMGRQRGTPIDDLSDDDLVAMSVAELRRLGLALDPHDYVIERHRGAMPQPAP
GHRERMAQLAATLNGTGLHVGGAGIDGAGVGTAIAAGRRLARHITSKEEN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttggtgccagaacgtgcgtaccctcaaacggtgagcaaaacagtggcagtcatcggtgcc
ggaatgacgggcctggcagccgcacaccacctacacagccacggctgtcgtcccgtcgtc
ctcgaagcggggcagggcgttggcggccaggtcaggtcccgtcgtcttggttctgatgtg
gtcgacatgggacctgaagccgtgcctcttcgcgccccgggcgtcgccgcactcgttgcg
gagctgggactaacggactccatgcgtcatcccgttcctgggcgcgtcttattgtcgagc
cggcgtggagtcgtcgagatgccgtccggcgtaacaccagtagggcccacgaagttcctc
cccactattgcctcgcgcatcctctcccctgccggactgttacgggccgggctcgaacct
ttcaacgctcacccgcaccttgacgacgtcagcgtcggccaattcatcgccgaaagattt
ggtgacgaggtgagccgcgccgtcgtcgacccgctactggggggtattcacgccgccgac
ctcaacacgttctcgctagcagttgccgcccccgctttggagcagacggtcaggaacggc
gactccatcgtcgccggaactctcaaacgcaatgctgccggacggtggtcgcagctccgc
catcattcacagcgatccggtccgcgcacccccgccaccgccacctggaaacacggcctg
atgatgttgccggaagcattggctagggagctcaccattcatacgaatacccgtgccagg
ggaatccgtcaggtcggccacgaatgggtagtcgatgtcactggtccgcatggcgttgga
tcggttgctgttgatgacgtcatcattgccacccccgccagggttgcgggtgccctgctt
gctaccgcatgcccgcgagcttccgagctgctgtcgcagtgtgaaagcactaccgttgcc
acgctggttatgcaggctgaccttactgaccacccgatcgctacggcccaaacgtggttc
attggttcggcatggtctgccctggtgcgtcaggtgaccaatctctcgacgacgtggcac
ctcgccaaacccacctttcggatcgccatgggtcggcagcgtggaacccccatcgacgat
ctatctgacgacgacctcgtcgccatgagcgtggcagagttgagacgtctcggactggct
cttgacccccacgactacgtcattgagcgacaccgcggcgccatgccgcaaccagctcct
ggccaccgggagcgcatggcccagctcgccgcgaccctcaacggcaccggtctccatgtg
ggaggggccggtatcgacggtgccggagttggcaccgcaattgctgctggacgccgtctc
gcacgccacatcacctcgaaggaggagaattag

DBGET integrated database retrieval system