KEGG   Propionibacterium acnes 266: PAZ_c22460Help
Entry
PAZ_c22460        CDS       T01971                                 

Gene name
ybbD
Definition
lipoprotein YbbD
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
paw  Propionibacterium acnes 266
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAZ_c22460 (ybbD)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PAZ_c22460 (ybbD)
Enzymes [BR:paw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PAZ_c22460 (ybbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2277746..2279716)
Genome map
AA seq 656 aa AA seqDB search
MRTDLLRLVSLSRWHNSRREHNMRRSTVKRRTVMAAAAGAFAASALPLSRAAADDTRSQL
ASMTLDQKIGQVLWTHVFGASADDASMARKNQLAFGDDVRTPAQAVQKYHLGGVLYFNWS
GNISTPTNPAAVAHLSNGLQEAARTSSTAPLAIAVDQEGGIVARITSPATEFPGNMALGA
VNDPRAARAQGAVLGRELAALGINVDFAPDVDVNTNPANPVIGVRSMGDDPVRVGVLGVE
QIRGIQSRGVAATAKHFPGHGDTQIDSHLGLPVVEYGRTTLERHLVPFRMAISAEVDMIM
TAHIIVKTLDPTMPATLSKKVLTGLLREQMGYRGIITTDALDMEGAQLAVMTEDEKGTYT
RLKAAADAEGNDPTAADEGHASAEFNAFMKPIRGRVAVQAFEAGSDILLNPHDADAVVTA
MRRAIADGRVSERRLDESVLRILSWKRRRCITGRPVDLAAADREVRSGRKVADDIAARSV
TMLVNDGTLPLKPSRVLVTGTRRGNPEYLVEPLRLAGFTPILVPSTGQEPTTADVEKAVT
VGVDAVIVVTHGLKRGDAQDAMVKALARTGNPVVEIMTGTPYDVAMTHRPHAALAVYSNR
KVSMVAAVAMMAGRNPVGRLPVRVPDPNGGTAFPRGFGLSYRATPGPYEGPGAKTA
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccgacctgcttagactggtcagcctcagccgttggcacaactccagacgagaa
cacaacatgaggagaagtaccgtgaaacgacgcactgtcatggccgccgcggctggagcc
tttgcggcatcagcccttccgctgtcgcgagcggcagcggatgacacccggtctcagctc
gcctccatgaccttggaccagaagatcggtcaagtgctatggacccatgtcttcggtgcc
agcgctgacgacgcttcaatggcgaggaagaatcagctggcctttggcgatgacgtccgc
actccggcccaggccgtgcagaagtaccaccttggcggggtgctgtacttcaactggtcc
ggtaacatctcgacgcccacgaatccggccgccgtcgcccacctttccaacggcctgcaa
gaggcggcgaggacgtcgtcgacggcgccgttggccatcgctgtcgatcaggagggcggt
atcgtcgcgcggattacctccccggccaccgaatttccagggaatatggcgctgggtgct
gtcaatgacccgcgcgctgcgcgtgcccaaggcgcggtgctcggtcgcgagctggctgcc
ctgggcattaacgtggacttcgccccggacgttgacgtcaacactaacccagccaatccc
gtaatcggggtgaggtccatgggggacgatccggtgcgcgtcggggtactcggcgtcgag
cagattcgcggcattcaatccagaggggttgcggccaccgccaagcatttcccaggtcat
ggtgatacccagatcgactcccatcttggtcttccggtcgtggagtacggtcgcactacc
ctggagcgtcacctggtgcccttccgcatggcgatcagcgcggaagtggacatgatcatg
acagcccacatcatcgttaagaccttggacccgacgatgccggccaccctgtcgaagaaa
gtgcttactggcctgctgcgcgaacagatggggtatcgcggcatcatcaccaccgacgcc
ctggacatggagggcgcccagcttgcggtcatgaccgaggacgagaagggcacgtatacc
aggctcaaggctgctgccgacgccgagggcaatgaccccacggcggccgatgaggggcat
gcgagtgccgagttcaacgcctttatgaaaccgatccgggggcgtgttgcggtgcaggct
ttcgaagccggatccgacattttgctgaacccccatgacgctgatgccgtcgtcacagcg
atgcggagggctatcgcggacggtcgggttagcgagcggcgtctcgacgaatcggtgctg
cgcatcctctcttggaagcggcgtcgctgcattacgggcaggccggttgacctcgcggcg
gccgatcgtgaggtacgatctggccgcaaggttgctgacgacatcgctgccaggtcggtg
acgatgctggtcaatgacggcactctgccgctcaagccgtcacgggtgctcgtcaccgga
acacgtcggggtaatccggagtacctcgtcgagccgttgcgcttggccggattcaccccg
attcttgttccgtcaaccggacaggaaccgacgacagccgatgtcgagaaagcggtgact
gtcggtgttgatgccgtcatcgtggtcacgcacgggttgaaacgtggagatgcccaggac
gccatggttaaggctctggcgcggaccgggaatccggtcgtggagattatgacagggacc
ccgtacgacgtggcgatgactcatcgcccgcatgccgcactagctgtctactccaaccgc
aaggtgagcatggttgcggctgtcgcgatgatggctggacgaaacccggtggggcgactt
ccggtacgggtgcccgacccgaacggaggcacagcttttccgcgcggtttcgggctcagc
taccgcgcgacgcccggaccctatgagggcccgggcgcgaagactgcttga

DBGET integrated database retrieval system