KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_00095Help
Entry
TIA2EST36_00095   CDS       T01655                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Pentose phosphate pathway
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pax00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21142..22071
Genome map
AA seq 309 aa AA seqDB search
MSGATAKVTVVGSINADMRVGVERFPGPGETLAGGEATLTPGGKGANQALAAARCGVQVA
MVGAVGKDPTAETALSLLSEGVGLDGVVRRDVLTGTAVVMVADSGENSIIVIAAANGTVD
AQTVRAQAERIQDADVVVCQGEIPPDGIAEAARGAKRFVFNLAPVVDVDPEVIRMADPLV
VNEHEAALVALALGSTTSRLEDDPDAALRELLNLGCRSVVITLGSAGCIVGGPEGFDAVA
AATVKAVDTVGAGDAFVGALAAELARGRTLVEGCRFATAVATLTVTKPGAQASYPSADEV
ESIRRGEHA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgcgacagcgaaagtcaccgtcgtcggatcgatcaatgccgacatgagggtc
ggcgtggagagatttccgggcccaggggagaccctggccggaggtgaggcgacactgacc
cccggcggtaagggagctaaccaggctcttgcggcggcgcgatgtggcgttcaggtggcg
atggtcggagctgtggggaaggacccgacggctgaaaccgccctatccctactatcggaa
ggcgttggccttgatggcgtggtccgtcgtgacgtattgacggggacggccgtcgtcatg
gtcgcggattccggagagaactcaattatcgtcatcgcggccgctaatgggaccgttgat
gcacagaccgtccgggctcaggccgagcgcatccaggacgctgacgtggtggtgtgtcaa
ggtgagattccgcctgacgggattgccgaagctgctcgcggcgccaaacgattcgtgttc
aatctggcaccggttgttgacgttgatccagaggtcattcgcatggccgacccgctggta
gttaacgaacatgaggcggccttggtggctcttgctttgggatcgacgacttctcgtctt
gaggatgatcctgacgcagctttgcgcgagctgttgaaccttgggtgccgcagtgttgtc
atcaccttgggatcggcaggatgcatcgtcggcgggccggaagggttcgacgccgtggct
gcggcgaccgtgaaggctgtcgataccgtcggtgcgggagatgctttcgttggtgcgttg
gctgcagaactggctcgtggccgtactcttgtcgagggttgccgttttgctaccgcggtg
gcgactttgacggtgaccaagccgggggcacaagcctcctaccccagtgctgacgaggtg
gagagcattcgtcgaggagaacacgcatga

DBGET integrated database retrieval system