KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_00455Help
Entry
TIA2EST36_00455   CDS       T01655                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pax01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pax01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pax00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pax00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pax00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pax00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pax00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
102615..103847
Genome map
AA seq 410 aa AA seqDB search
MAVVTVTHMIATVDRSVVGAIHGRMGTTRHRSGVVMSKKKKVGILTAGGDCPGLNAAIRG
FGKAAIRQHDMELIGIQDGFLGLAGNRTISLDPRALSGILTVGGTILGTSRDKVNHMIID
GEERDMVPTIVENYEKLGLDALVTLGGGGTAKNAYKLAKAGLNVLHLPKTIDNDIVGTDD
SFGFSTALEIATEAIDRLHSTAHSHHRIILAEIMGHRAGWLALGSGIAGGADVILLPEVP
YKLDSIVQAVENRQKQGLNFSVIAVAEGARDEADSAAMAGAQALVDASKTSETKAAAKKA
KKDLEHSMRDNTLKLATQLEEATGLESRVSILGYVQRGGIPCAHDRLLATRLGTVGAKLV
DDGEFGIMVAAQGGDATTVPLKDVAGKVKYVPADHPWVKAARQVGTGLGD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgtcacagtgacgcacatgattgccacagtggaccgcagtgttgtcggcgct
atccatggaaggatgggtaccacccgacacagatcaggagtcgtcatgtccaaaaagaag
aaggtcggcatcctcaccgcaggcggtgattgccccgggctcaacgccgctatccgcgga
tttggcaaggctgccatccgccagcacgacatggagctcatcggtattcaggacggcttt
cttggattggcagggaaccgcaccatctcccttgacccgcgtgccctctcaggcatcttg
acggtcggcgggaccatcctgggaactagccgtgacaaggtcaatcacatgattatcgac
ggcgaggaacgggatatggtccccaccatcgtcgagaattacgagaagctgggacttgac
gctttggtgactttgggtggcggtggcaccgccaagaacgcgtacaagctcgctaaggcc
gggctgaacgtcctgcatctgcccaagacgattgacaacgacatcgtcggaaccgacgac
tccttcgggttctcgacagcactggagattgccacggaggccatcgaccggctgcactcc
accgcccattcccaccaccgcatcatcctcgctgagatcatgggccaccgtgccggctgg
ctggccctcggctcgggcatcgctggtggcgctgacgtcatcctgctgcccgaggtgccc
tacaagctggactccatcgtccaggcggtggaaaaccggcaaaagcaggggttgaatttc
tcggtcatcgcggtggctgagggagctcgcgatgaggctgattcggccgcgatggctgga
gctcaggccctcgttgacgcttccaagacctccgagacaaaggcggctgccaagaaggcc
aagaaggaccttgagcattccatgcgtgacaacaccctcaaattggctactcagcttgag
gaggccaccgggctggaatcgcgagtctcgatcctcggctatgtgcagcgcggtggtatc
ccgtgcgcccacgaccgtctgctcgcgacccggctgggaaccgtgggtgccaagctcgtt
gacgacggcgagttcggcatcatggtcgccgctcagggcggagacgccacgaccgttccg
ttgaaagacgtcgctggcaaggttaaatacgtacctgccgaccacccatgggttaaggcg
gcccgacaggtcggaaccggtctaggtgactga

DBGET integrated database retrieval system