KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_00455Help
Entry
TIA2EST36_00455   CDS       T01655                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIA2EST36_00455
   01230 Biosynthesis of amino acids
    TIA2EST36_00455
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST36_00455
   00030 Pentose phosphate pathway
    TIA2EST36_00455
   00051 Fructose and mannose metabolism
    TIA2EST36_00455
   00052 Galactose metabolism
    TIA2EST36_00455
  Energy metabolism
   00680 Methane metabolism
    TIA2EST36_00455
Enzymes [BR:pax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TIA2EST36_00455
Protein phosphatases and associated proteins [BR:pax01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TIA2EST36_00455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
102615..103847
Genome map
AA seq 410 aa AA seqDB search
MAVVTVTHMIATVDRSVVGAIHGRMGTTRHRSGVVMSKKKKVGILTAGGDCPGLNAAIRG
FGKAAIRQHDMELIGIQDGFLGLAGNRTISLDPRALSGILTVGGTILGTSRDKVNHMIID
GEERDMVPTIVENYEKLGLDALVTLGGGGTAKNAYKLAKAGLNVLHLPKTIDNDIVGTDD
SFGFSTALEIATEAIDRLHSTAHSHHRIILAEIMGHRAGWLALGSGIAGGADVILLPEVP
YKLDSIVQAVENRQKQGLNFSVIAVAEGARDEADSAAMAGAQALVDASKTSETKAAAKKA
KKDLEHSMRDNTLKLATQLEEATGLESRVSILGYVQRGGIPCAHDRLLATRLGTVGAKLV
DDGEFGIMVAAQGGDATTVPLKDVAGKVKYVPADHPWVKAARQVGTGLGD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgtcacagtgacgcacatgattgccacagtggaccgcagtgttgtcggcgct
atccatggaaggatgggtaccacccgacacagatcaggagtcgtcatgtccaaaaagaag
aaggtcggcatcctcaccgcaggcggtgattgccccgggctcaacgccgctatccgcgga
tttggcaaggctgccatccgccagcacgacatggagctcatcggtattcaggacggcttt
cttggattggcagggaaccgcaccatctcccttgacccgcgtgccctctcaggcatcttg
acggtcggcgggaccatcctgggaactagccgtgacaaggtcaatcacatgattatcgac
ggcgaggaacgggatatggtccccaccatcgtcgagaattacgagaagctgggacttgac
gctttggtgactttgggtggcggtggcaccgccaagaacgcgtacaagctcgctaaggcc
gggctgaacgtcctgcatctgcccaagacgattgacaacgacatcgtcggaaccgacgac
tccttcgggttctcgacagcactggagattgccacggaggccatcgaccggctgcactcc
accgcccattcccaccaccgcatcatcctcgctgagatcatgggccaccgtgccggctgg
ctggccctcggctcgggcatcgctggtggcgctgacgtcatcctgctgcccgaggtgccc
tacaagctggactccatcgtccaggcggtggaaaaccggcaaaagcaggggttgaatttc
tcggtcatcgcggtggctgagggagctcgcgatgaggctgattcggccgcgatggctgga
gctcaggccctcgttgacgcttccaagacctccgagacaaaggcggctgccaagaaggcc
aagaaggaccttgagcattccatgcgtgacaacaccctcaaattggctactcagcttgag
gaggccaccgggctggaatcgcgagtctcgatcctcggctatgtgcagcgcggtggtatc
ccgtgcgcccacgaccgtctgctcgcgacccggctgggaaccgtgggtgccaagctcgtt
gacgacggcgagttcggcatcatggtcgccgctcagggcggagacgccacgaccgttccg
ttgaaagacgtcgctggcaaggttaaatacgtacctgccgaccacccatgggttaaggcg
gcccgacaggtcggaaccggtctaggtgactga

DBGET integrated database retrieval system