KEGG   Cutibacterium acnes TypeIA2 P.acn31: TIA2EST36_00735Help
Entry
TIA2EST36_00735   CDS       T01655                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pax  Cutibacterium acnes TypeIA2 P.acn31
Pathway
pax00010  Glycolysis / Gluconeogenesis
pax00030  Pentose phosphate pathway
pax00051  Fructose and mannose metabolism
pax00052  Galactose metabolism
pax00680  Methane metabolism
pax01100  Metabolic pathways
pax01110  Biosynthesis of secondary metabolites
pax01120  Microbial metabolism in diverse environments
pax01130  Biosynthesis of antibiotics
pax01200  Carbon metabolism
pax01230  Biosynthesis of amino acids
Module
pax_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST36_00735
   00030 Pentose phosphate pathway
    TIA2EST36_00735
   00051 Fructose and mannose metabolism
    TIA2EST36_00735
   00052 Galactose metabolism
    TIA2EST36_00735
  Energy metabolism
   00680 Methane metabolism
    TIA2EST36_00735
Enzymes [BR:pax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TIA2EST36_00735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AEW82754
Position
complement(172928..173878)
Genome map
AA seq 316 aa AA seqDB search
MIVTVTLNPSIDRTAPIAGPLRRGQVNRLGSSTEVAAGKGVNISRVLRGAGIETCAVVPA
GAKGRLTLGLNHDDIPHQVVPVAAAVRTNLTITEPDGTTTKINEPGADLSPEELTAVEEA
IVEKSSGAQWVVLSGSLPPGVPTHWYATMTDRLHEVGVKVAVDTSDQPLQELAVRLPDCA
PDLVKPNSVELGQLCGIDGGSLESAATRGQFDDVVVAARGLHGIAEVIVTLGGTGALLIT
EHDAWHARPEPVKVKSTVGAGDSSLAGFLLARTRGDQPENCLRAAVAWGTAAAALPGSTM
PTPSQADAIHVSLTHL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcaccgtcacgctcaacccgagcattgaccgcacagcgcccatagctgggccg
ctgcggcgcgggcaggtgaaccgactcggcagttccaccgaggtcgccgccggtaagggg
gtcaacatctcacgagtccttcgtggggctggaatcgaaacctgcgccgtggtgccagcc
ggagccaagggccgcctgaccctcggcctcaaccacgacgacatcccgcaccaagttgta
cccgttgcggcagcggtgagaaccaacctcaccatcaccgaacctgacggcactacaacc
aagatcaatgagcccggagccgacctcagtcctgaggagctgaccgcagttgaggaggcc
atcgtcgagaagtcctccggcgcgcaatgggtcgtactgtcaggatccttacccccgggc
gtacccacacattggtatgccacaatgaccgaccgcctccatgaggtcggcgtcaaggtc
gccgtcgacacctccgatcaacccctccaagaactggcggtccgcctccccgactgtgcc
cctgacctcgtcaagccgaactccgtcgagctcggccaactatgcgggattgacggcggc
tccctcgagtccgctgccacaaggggacagttcgacgacgttgtcgtggccgcccgaggt
ctgcacggcatcgccgaggtaatcgtcaccttgggcgggaccggcgctctgctcatcacc
gaacacgacgcctggcacgcccggccagagccggtcaaggtgaagtcgactgttggcgcc
ggagactcctccctggccggattcctgctggcgcgcacccgcggcgaccagcccgaaaac
tgtctgcgcgccgccgtggcgtggggcacagcagccgccgctctaccggggtcaaccatg
ccaaccccgtcacaggccgacgccattcacgtcagcctcacccacctgtaa

DBGET integrated database retrieval system