KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_01335Help
Entry
TIA2EST36_01335   CDS       T01655                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pax00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315305..315874
Genome map
AA seq 189 aa AA seqDB search
MSVDRERVAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTFDI
SHDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQVQ
ERLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRGILRNPATRAE
AMGLITAGR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgttgatcgcgagcgagtcgcggcagctatccgcgagtttcttctggcggtcggc
gaggatcccgatcgggaaggcctgcgcgatactccaatgcgagtggcccaggcggccgag
gagctatttggcggattgagccaagatccgggggagttgctggcaacgaccttcgacatc
tcccacgacgagatggtgttggtgcgtgatattgagttgcagtcgatgtgtgagcaccat
ctgctgcccttcatcggggtagcgcacgtcggttatattccggctagggacggccgggtg
acggggttgagtaagatcgcgaggttggtggaggtctatgcgcgtcgaccccaggtacag
gagaggttgacgacccaggtggccgacgccttggtagaacatttggacgctcgtggcgtg
atcgtggttgttgaggccgagcacatgtgcatgacgacgaggggggtccgcaagccgggg
gcccggacggtgacctccgcggtgcgcgggattctgcgcaacccagcgacgcgggccgag
gcgatggggctgatcacggctggacgttga

DBGET integrated database retrieval system