KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_01335Help
Entry
TIA2EST36_01335   CDS       T01655                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TIA2EST36_01335
Enzymes [BR:pax01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TIA2EST36_01335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315305..315874
Genome map
AA seq 189 aa AA seqDB search
MSVDRERVAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTFDI
SHDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQVQ
ERLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRGILRNPATRAE
AMGLITAGR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgttgatcgcgagcgagtcgcggcagctatccgcgagtttcttctggcggtcggc
gaggatcccgatcgggaaggcctgcgcgatactccaatgcgagtggcccaggcggccgag
gagctatttggcggattgagccaagatccgggggagttgctggcaacgaccttcgacatc
tcccacgacgagatggtgttggtgcgtgatattgagttgcagtcgatgtgtgagcaccat
ctgctgcccttcatcggggtagcgcacgtcggttatattccggctagggacggccgggtg
acggggttgagtaagatcgcgaggttggtggaggtctatgcgcgtcgaccccaggtacag
gagaggttgacgacccaggtggccgacgccttggtagaacatttggacgctcgtggcgtg
atcgtggttgttgaggccgagcacatgtgcatgacgacgaggggggtccgcaagccgggg
gcccggacggtgacctccgcggtgcgcgggattctgcgcaacccagcgacgcgggccgag
gcgatggggctgatcacggctggacgttga

DBGET integrated database retrieval system