KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_01370Help
Entry
TIA2EST36_01370   CDS       T01655                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pax00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321215..322060
Genome map
AA seq 281 aa AA seqDB search
MINVGSATNSHPARTLVMGVVNVTPNSFSDGGMWADPEVAIRHARDLVVEGADIIDVGGE
STRPGTERTPEHEELRRVLPVVKALVADGVAVSVDTMRASVAKAVVEAGATIVNDVSGGK
AEPEILDVVADAGVDYVLMHWRGQSATMQNLVDYDDVVADVISETSQQVDAAIAAGIDRR
RIIVDPGIGFSKTSEHNWQLMNAVDAFQEGFADLRVLWGVSRKRFLGELLAQNGEDRPAL
ERDASTMALSTYFALHHAWCVRTHEVRANRDAVETVARLLA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatgtcggctcggctaccaactcgcatcccgcccgcaccctcgtcatgggggtc
gtcaacgtcactcctaactcgttctctgacggaggcatgtgggccgatcctgaggtggcc
atccgccacgctcgcgacctcgttgtcgaaggagctgacatcatcgacgtcggtggtgaa
tcgacccgtccgggcaccgaacgcacccccgagcacgaagaattgcgccgcgtcctgccc
gtcgtcaaagctttggtggccgacggggtagccgtctccgtcgacactatgcgcgcctca
gtggccaaggctgttgtcgaggcaggagccaccatcgtcaacgacgtctctgggggcaag
gctgaaccggaaatccttgatgtcgttgccgacgctggcgtcgattacgttctcatgcac
tggcgcggtcaatccgccactatgcagaaccttgtcgactatgacgacgtggtagccgac
gtcatttctgagacctcccagcaggtcgacgcagctattgccgctggaatcgaccgtagg
cgcatcatcgtcgacccgggcattggtttctccaagacttccgagcacaactggcagctc
atgaacgccgttgacgccttccaagaaggatttgccgaccttcgtgtcctgtggggagtt
agtcgcaagcgcttccttggtgaacttctcgcccagaacggggaggaccgtccggccctc
gaacgcgatgcgagcaccatggccctgtcgacttatttcgcccttcatcacgcctggtgt
gtgcgcacccacgaagttcgggccaaccgcgacgccgtggagaccgttgcccgccttctc
gcctga

DBGET integrated database retrieval system