KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_01380Help
Entry
TIA2EST36_01380   CDS       T01655                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TIA2EST36_01380
Enzymes [BR:pax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     TIA2EST36_01380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322480..323037
Genome map
AA seq 185 aa AA seqDB search
MKTVFSLGSNMGDPFAHLRDAVRLIAETPGIHDVVVSPVYVTAPIGGVEQDDFLNLIVVA
TSDLPPSVLLERAHVIEAAHGRDHTIPNGPRTLDVDLIRVGDETVTTDELTLPHPRAHKR
AFVLVPWRDADPEAELPGYGRIADLVASFDADELADAVKPYSRQIDVAGVTVAGEWDERH
DEEDV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgtattcagcctgggttccaatatgggagacccttttgcccatctgcgagac
gccgtccgcctgatcgccgaaactcccggtattcacgacgtcgtcgtttcgcccgtctat
gtcaccgctccgatcgggggagtggagcaggatgacttcctcaacctcatcgtcgttgcg
actagcgaccttcctccgtcagtcctgttggagcgcgcccatgtcatcgaggcagcccac
gggcgcgatcacaccatcccgaatggtcctcgcaccctcgacgttgatctcattcgcgtt
ggcgacgagaccgtcaccaccgacgagttgacccttccacacccccgtgcacataagcgc
gccttcgttctggtgccgtggcgcgacgccgaccctgaggctgaattgcccgggtacggt
cggatcgccgatctggtcgcctccttcgatgctgacgagctggctgacgccgttaagcct
tattcgcgtcagattgacgtagctggggtcaccgttgcaggagaatgggacgagaggcac
gacgaggaggatgtatga

DBGET integrated database retrieval system