KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_01610Help
Entry
TIA2EST36_01610   CDS       T01655                                 

Definition
uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pax00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
367446..369161
Genome map
AA seq 571 aa AA seqDB search
MTDEAHQPTPQPAGDLGTASSQARVQFVGTGPGDPNLLTLGAVDAINRAQVIVISCAEHR
MLLGSDFLGLRPDVRIVLAGGVDEEAAVLPSQPGTGAPTPVDVDEHCADVTATVIDAASQ
GLEVVRLVSGDPFLDGDIGAEAAAVARADYDVDVVPGVTGMTAVPEYAGLTLHGHDVQLI
GDAACQRDIAGHGSNWSDQGLVVVNTEAGKLKEVVKHAIESGRGEDEPAALICHGATTQQ
TTHTVTLGELPQTAKTARLGDAEPVHVAIGKVVEAPEREQLDWYESKPLFGWNILIPRTR
DHSATLPSRLQSYGAHSLDVPTISMEPPRTPQQMDKAIRGLVEGRYEWVVFTSANAVRAV
SEKLEQIGLDARAYSGLRIAAIFDSTINALAEWGVRPDFVPSGEQSTRALAAVFPAFDEA
LDPINRVFVPRADIATESLSADLSELGWEVEDVVGYRTVRAAPPPAETREAIKTGKFDAV
VFTSSTTVRNLVGIAGKPHKHTVVAAVGMRTAETCREHGLTVDVIAPEPTALSLADALAD
FAAKRRDDMVAKGLPVVRPSQRKRRGRHPSR
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgaggctcaccagccgacgccgcagccggccggtgatctgggcactgcgtcg
tctcaggccagggtgcagtttgtgggtaccggtccaggagatccgaatctgttgaccctt
ggagctgttgacgccatcaatcgcgctcaggtcatcgtcatttcgtgcgctgagcaccgc
atgctgctgggcagtgattttcttggacttcgccccgacgtcagaatcgtgttggcgggt
ggtgttgatgaagaagccgccgtcctacccagtcagccagggactggcgctccgactccc
gtcgacgtggacgaacactgcgctgacgttactgccaccgttattgatgccgcctcccaa
ggccttgaagtcgttcgtctcgtttctggggatcctttccttgatggcgatattggcgcg
gaggctgccgctgtggctcgcgctgattatgacgtcgacgttgttcccggtgtcactggc
atgaccgctgtcccggagtacgccggactgaccttgcatggccatgacgtccagctcatc
ggggacgctgcatgtcagcgcgatattgctggacatggttcgaactggtcagatcagggg
cttgtcgtcgtcaataccgaggcaggcaagcttaaagaagtcgtcaaacacgcgattgaa
tctggacgcggtgaggatgagcccgcggcccttatctgccatggcgcgacgacccagcag
accactcataccgtcaccctcggtgagttaccacagaccgctaagacagcgcgcctgggt
gacgctgagccggttcacgtcgccatcggcaaagttgtcgaagcccccgaacgtgagcag
ctcgattggtacgagtccaagccgttatttggctggaacattctcatcccgcgcacccgt
gaccactccgcgaccctgccctcgcgactacagagttacggtgctcattcccttgatgtt
cccacgatttcgatggagcctccgcgtactcctcagcagatggataaagctattcgcggt
cttgttgagggacgttacgagtgggtcgtctttacttctgccaacgcggtacgtgccgtt
tcggagaagctagagcagatcggtctggacgctcgcgcgtactcaggcttgcggattgcc
gcgatcttcgactcgactatcaacgctttggctgaatggggtgttcgacccgatttcgtg
ccatcgggcgagcagtccacccgagctctggccgcggtattcccggcctttgacgaggcc
ctcgaccccattaaccgcgttttcgtgccgcgtgccgacatcgccactgagtccctgtcg
gccgacctatctgaactgggatgggaggtcgaagacgtcgtcgggtatcgcaccgtgcga
gctgccccgccgccagctgagacccgtgaagccattaagaccggcaaattcgacgccgtc
gtgtttacctcctcgacgactgtgcgcaacctcgtcggtattgccggaaaaccacataag
cacaccgtggtcgccgccgttggtatgcgcaccgctgaaacctgccgtgagcacggcctg
accgtcgatgttatagcccccgagccgactgcgttgagcttggctgacgccttggcggat
ttcgctgcgaagcgccgtgacgacatggttgccaagggcctgccggtagttcggccctcc
cagcgcaagcgtcgtggccgtcatccgtcacgctga

DBGET integrated database retrieval system