KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_01810Help
Entry
TIA2EST36_01810   CDS       T01655                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIA2EST36_01810
   01230 Biosynthesis of amino acids
    TIA2EST36_01810
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST36_01810
  Energy metabolism
   00680 Methane metabolism
    TIA2EST36_01810
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIA2EST36_01810
Enzymes [BR:pax01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TIA2EST36_01810
Exosome [BR:pax04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TIA2EST36_01810
  Exosomal proteins of melanoma cells
   TIA2EST36_01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(406831..407580)
Genome map
AA seq 249 aa AA seqDB search
MTAKLILLRHGESEWNSKNLFTGWVDVDLNEKGEGEARHAADLLKQENLLPDIVHTSLLR
RAIHTAYLALDGCDRHWIPVHRSWRLNERHYGALQGLNKAETKEKYGNDQFMAWRRSYDV
RPPDLDRDSEFSQFHDPRYADIPASERPVAECLKDVVARMVPYFTSDIAADLKDGKTVLV
AAHGNSLRALVKHLDEISDEDIAGLNIPTGIPLFYELDDNLKPVTRGGRYLDPEAAAAGA
KVVANQGNK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagctcatcctgctccgccatggcgagagcgaatggaactccaagaacctc
ttcaccggctgggtggacgtcgatctcaacgagaagggcgagggcgaggctcgtcacgcc
gccgacctgctcaagcaggaaaacctcctgcccgatatcgtccacacctcgctgctacgt
cgtgctatccataccgcctacctagcccttgacggctgcgaccgccattggatcccggtg
catcgctcctggcgcctcaacgagcgtcactacggtgcgctgcagggtctcaacaaggct
gagaccaaggagaagtacggcaacgaccagttcatggcttggcgtcgctcctacgatgtt
cgtccaccggaccttgaccgcgacagcgaattcagccagttccatgacccgcggtacgcc
gacatcccggcgtccgagcgtccggtcgccgagtgtctcaaagacgtcgtggcccgcatg
gtgccgtacttcacctctgatattgctgccgaccttaaggacggcaagacggtgctcgtc
gctgctcacggtaactccctgcgcgccctcgtcaagcacctcgacgagatcagtgacgag
gacatcgccggcctcaacatcccgaccggtatcccgctgttctacgagcttgacgacaac
ctcaagcccgtgactagggggggccgctacctcgaccctgaggccgctgccgccggcgcc
aaggtagtcgctaaccagggaaacaagtaa

DBGET integrated database retrieval system