KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_02610Help
Entry
TIA2EST36_02610   CDS       T01655                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TIA2EST36_02610
Enzymes [BR:pax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TIA2EST36_02610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
572521..573486
Genome map
AA seq 321 aa AA seqDB search
MMDDPFDLLRPMTVTVRVSAKVNLALGVGGLAPDGFHPLATVFEAICIYDEVAVTRRDDS
RITLTVSGEDADQVPTDETNLAWRAVELVREEFASEWGKRGHGADIHIDKSIPVAGGMAG
GSADAAGALMAAAALCRLPYSPEELQPLAAQLGSDVPFCLTGGVALGRGRGDRLAPVICR
GRHRWVFATSNQGLSTPAVYRRFDELGGTPGGETVPNDLISALTRGDLDAVAASLSNDLQ
AAAIDLRPELEEVLTVGREVGALTALVSGSGPTCAFLVRDTAGAKKVSAAVSNLPQVHRT
RTARGPAAGAQLLPGPVGSFA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgatccgtttgacttgctccggccgatgaccgtgacggtgcgggtcagcgcc
aaggtcaatctggcgctcggggttggtggccttgcgcccgacggctttcacccgttggcg
actgtcttcgaagctatctgcatttacgatgaggtggcggtgactcgtcgcgacgattcg
cgcatcaccctcaccgtctcaggagaggacgccgatcaggtccctaccgacgagacgaat
ttggcctggcgagctgtagaactcgttcgcgaggaattcgcttcagaatgggggaaacgt
ggccatggcgccgacattcacatcgataaatcgatcccggtcgctggtgggatggctgga
ggatcagctgacgcagcgggcgccctcatggcagcggccgcgctgtgtcggctcccttac
tcccccgaggaattacaaccgttggctgctcagcttggctccgacgtgcccttctgtctc
accggtggagtggcgttagggcgaggtcgaggagaccgtcttgcgccagtgatctgccga
ggacgtcatcgctgggtgttcgcgacatcgaatcagggactgtccaccccggctgtctac
cgacgtttcgacgagttgggcggcacccctgggggagaaacggtgcccaatgacctcatc
tcggccttgacccgcggcgatcttgatgctgtcgctgccagtttgagcaatgacttacag
gccgctgccatcgaccttcggcccgaactcgaagaggtgttgacggttgggcgagaggtg
ggtgcgttgaccgctttggtttctggatcggggccgacctgcgccttcctcgtccgggac
accgctggcgccaaaaaggtgagcgctgctgtgtccaatctgcctcaggttcatcgcacc
cgaactgcccgcggtccagctgcgggagcgcagctcctgcctggcccggtggggagcttt
gcatga

DBGET integrated database retrieval system