KEGG   Cutibacterium acnes TypeIA2 P.acn31: TIA2EST36_03625Help
Entry
TIA2EST36_03625   CDS       T01655                                 

Definition
(GenBank) Putative sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pax  Cutibacterium acnes TypeIA2 P.acn31
Pathway
pax00010  Glycolysis / Gluconeogenesis
pax00052  Galactose metabolism
pax00500  Starch and sucrose metabolism
pax00520  Amino sugar and nucleotide sugar metabolism
pax00521  Streptomycin biosynthesis
pax01100  Metabolic pathways
pax01110  Biosynthesis of secondary metabolites
pax01120  Microbial metabolism in diverse environments
pax01130  Biosynthesis of antibiotics
pax01200  Carbon metabolism
Module
pax_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pax_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST36_03625
   00052 Galactose metabolism
    TIA2EST36_03625
   00500 Starch and sucrose metabolism
    TIA2EST36_03625
   00520 Amino sugar and nucleotide sugar metabolism
    TIA2EST36_03625
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TIA2EST36_03625
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TIA2EST36_03625
Enzymes [BR:pax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TIA2EST36_03625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase Hydant_A_N FGGY_N GST_N_2
Motif
Other DBs
NCBI-ProteinID: AEW83320
Position
785847..786917
Genome map
AA seq 356 aa AA seqDB search
MLSVGIDIGGTKVAAGVVDESGQIVRRIQRLTPSRSPEAVEDAIVESVRELARNLPICAV
GIGAAGWIDTEQALVRFSPHLAWRNEPLRDRLSERITVPVLVDNDANAAAWAEFRFGAGQ
GSRVMVCLTLGTGIGGALVINGRMFRGRYGMAGEFGHMTVVPDGHWCPCGNRGCWEQYAS
GNSLVRDARALLAEGAPGAQDLLGYVADRNPGNLIGPDVTRAAVDGDRLAIELIADIGIW
LGRGMANLAAALDPDLFVIGGGVSAAGDLLLEPARTVYARTLTGRGFRPMADIQKAHFGN
DAGLIGAADLARHSINEPPGMARGFWPRRRTAVRKPRRTLRQSLSETLAGPVVRDK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcttagcgttggcatagatattggcggcacgaaggttgccgctggtgtcgtagatgaa
agtggccagattgttcggcgtattcagcgcctgacaccctcgcgcagccccgaggctgtt
gaggacgctatcgttgagtcggtccgtgaattggctcgtaacctccctatctgtgctgta
ggcatcggggcagccggctggatagacactgaacaggcgctcgtgcggttttccccgcat
ttagcatggcgtaatgagccgctgcgcgatcgtctgtctgagcgcatcactgtgcctgtt
ctcgtcgataatgacgccaatgcggccgcgtgggctgagttccggttcggagccggacaa
ggatcacgggtcatggtgtgcctgacgttgggaacgggtatcgggggtgcactcgttatc
aatgggcggatgttccgcggccgatacggcatggccggagaattcggacatatgacggtg
gttcccgatggccactggtgcccatgtggcaaccgtggttgctgggagcaatacgcctcc
ggaaattccctcgtgagggatgctcgagcgttgcttgccgagggagctcccggtgctcag
gatctgttgggttatgtagctgaccgcaatccgggcaacctcattggtcctgatgtcaca
cgcgcagcggtcgatggcgatcgtcttgccattgagctcattgcagacattggcatctgg
ctgggccgtggaatggcgaacttggcagcagccttagatccagatctctttgtcattggt
gggggagtgagcgccgccggagacctcttgcttgaacctgcgcgcactgtatatgcccgc
acgctgacgggccgggggttccgcccgatggccgatattcagaaggcacatttcggtaac
gatgctgggcttatcggcgccgcagacttggctcgccactccatcaacgaaccgccgggc
atggctcgcgggttctggccacgtcgtcgtactgctgtccgcaagccacgccgtactttg
cgtcagagcctgagtgaaactctcgccggtccggttgttcgggacaagtga

DBGET integrated database retrieval system