KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_03950Help
Entry
TIA2EST36_03950   CDS       T01655                                 

Definition
magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pax00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857427..858248)
Genome map
AA seq 273 aa AA seqDB search
MPTISQVDDVYHLSADEQHIYGDPLGVPSCTNLQLRQVPVVELPVGVTEDRVAGTLDVET
ALVRGQQRFQPGLLASAHRGILYVDEVNLLDDHIVDILLDSAAMGVNTVEREGMSVIHPS
RFSLVGTMNPEEGQLRPQLLDRFGLCVTVQGETDPEVRMEIVQRRLSFEDDPDGFITEWS
SHSRRLAERIENAMTLVQSVEIPKNILSTAVQICLDSNIDGHRGDITIIHAARALAAWAG
RDRIIQDDLEKVAPLVLNHRLQYASGVARAPRG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccatttctcaggttgacgacgtttatcatctaagcgctgatgagcaacatatc
tacggagatcctttaggggttccaagctgcacgaatctacagcttcggcaagttccagta
gtggagctaccggttggggtcaccgaagacagggttgccgggacacttgacgtagaaaca
gccttagtccgggggcagcaaaggttccagccaggcctgctagcgtcggcacaccgagga
atactgtacgtcgatgaggtcaatcttcttgacgatcacatcgtcgacatcttgctggat
tctgcagctatgggagtgaataccgttgaacgggaaggcatgagcgtgatccatccatcc
cgtttcagcttggtaggaacgatgaatcccgaagaaggccagctacgtccacaattgctg
gatcggttcggactgtgcgttacggtccagggagagaccgatcccgaggtacggatggag
atcgtacaacgtcgactatcattcgaagacgatccggatggatttattacagaatggtcc
tcgcatagcagacgattagccgaacgcatcgaaaatgccatgactctagtccaatccgtc
gagattccgaaaaatattctttccacagcggtacagatctgtctggattccaacatcgac
ggccatcgaggcgacatcaccatcattcacgccgcacgagccttagcagcgtgggcggga
cgagaccgaattattcaggacgatctcgaaaaagtcgcccccctggtcctcaatcatcgg
ttacaatatgcgtcgggcgtcgcgcgggctccacgcggatag

DBGET integrated database retrieval system