KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_03950Help
Entry
TIA2EST36_03950   CDS       T01655                                 

Definition
magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIA2EST36_03950
Enzymes [BR:pax01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     TIA2EST36_03950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857427..858248)
Genome map
AA seq 273 aa AA seqDB search
MPTISQVDDVYHLSADEQHIYGDPLGVPSCTNLQLRQVPVVELPVGVTEDRVAGTLDVET
ALVRGQQRFQPGLLASAHRGILYVDEVNLLDDHIVDILLDSAAMGVNTVEREGMSVIHPS
RFSLVGTMNPEEGQLRPQLLDRFGLCVTVQGETDPEVRMEIVQRRLSFEDDPDGFITEWS
SHSRRLAERIENAMTLVQSVEIPKNILSTAVQICLDSNIDGHRGDITIIHAARALAAWAG
RDRIIQDDLEKVAPLVLNHRLQYASGVARAPRG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccatttctcaggttgacgacgtttatcatctaagcgctgatgagcaacatatc
tacggagatcctttaggggttccaagctgcacgaatctacagcttcggcaagttccagta
gtggagctaccggttggggtcaccgaagacagggttgccgggacacttgacgtagaaaca
gccttagtccgggggcagcaaaggttccagccaggcctgctagcgtcggcacaccgagga
atactgtacgtcgatgaggtcaatcttcttgacgatcacatcgtcgacatcttgctggat
tctgcagctatgggagtgaataccgttgaacgggaaggcatgagcgtgatccatccatcc
cgtttcagcttggtaggaacgatgaatcccgaagaaggccagctacgtccacaattgctg
gatcggttcggactgtgcgttacggtccagggagagaccgatcccgaggtacggatggag
atcgtacaacgtcgactatcattcgaagacgatccggatggatttattacagaatggtcc
tcgcatagcagacgattagccgaacgcatcgaaaatgccatgactctagtccaatccgtc
gagattccgaaaaatattctttccacagcggtacagatctgtctggattccaacatcgac
ggccatcgaggcgacatcaccatcattcacgccgcacgagccttagcagcgtgggcggga
cgagaccgaattattcaggacgatctcgaaaaagtcgcccccctggtcctcaatcatcgg
ttacaatatgcgtcgggcgtcgcgcgggctccacgcggatag

DBGET integrated database retrieval system