KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_04505Help
Entry
TIA2EST36_04505   CDS       T01655                                 

Definition
(GenBank) putative Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
pax00010  Glycolysis / Gluconeogenesis
pax00620  Pyruvate metabolism
pax00640  Propanoate metabolism
pax00680  Methane metabolism
pax01100  Metabolic pathways
pax01110  Biosynthesis of secondary metabolites
pax01120  Microbial metabolism in diverse environments
pax01130  Biosynthesis of antibiotics
pax01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST36_04505
   00620 Pyruvate metabolism
    TIA2EST36_04505
   00640 Propanoate metabolism
    TIA2EST36_04505
  Energy metabolism
   00680 Methane metabolism
    TIA2EST36_04505
Enzymes [BR:pax01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TIA2EST36_04505
Lipid biosynthesis proteins [BR:pax01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TIA2EST36_04505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEW83491
Position
966671..967309
Genome map
AA seq 212 aa AA seqDB search
MFQITTVPSMPLKPGAVGRPVFGQEAAVVDEEGHELPAGKEGFLVLKNPWPAMMRTLYKD
PDRYLEAYWTKYPGVYLTGDSARIDDDGYIWIIGRADDVIKVSGHRIGTAEVESALIFHP
AVAEAAAIGLPHEVKRNAIHMVVVLNHSFEPTKNLVSDIRGHVAETLSPIAKPDTIEFVD
KLPKTRSGKIVRRVLKARVLGGDEGDLSTLED
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgttccagatcaccactgtgccgtcgatgccgctcaaaccaggtgccgttgggcgtccg
gtctttggccaggaggctgctgttgtcgacgaggagggccatgagctccctgcgggcaaa
gagggcttcctcgtcctcaaaaacccgtggccggccatgatgcgcaccctgtataaggat
ccggatcgatacctcgaggcgtactggacgaagtacccgggtgtctatctcaccggtgat
tccgcacgaatcgatgatgacggctacatatggatcatcggacgtgctgacgacgtcatc
aaggtatccggtcaccgcatcggtactgctgaggtggagtccgctctgatctttcacccc
gccgtcgccgaggctgcggccatagggctgcctcacgaagtgaagcgcaacgcgatccat
atggtcgttgtactcaatcatagtttcgagccgacgaagaatctcgtctctgatatccgc
ggacacgtcgccgaaaccctctcgccgattgccaagcctgacaccatcgagttcgtcgac
aagttgccgaagacccgctccggcaagatcgtgcgtcgcgtcctcaaagctcgtgtcctg
ggtggagacgagggagacctgtcaaccctagaggactga

DBGET integrated database retrieval system