KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_05585Help
Entry
TIA2EST36_05585   CDS       T01655                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TIA2EST36_05585
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TIA2EST36_05585
Enzymes [BR:pax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TIA2EST36_05585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1202238..1203038
Genome map
AA seq 266 aa AA seqDB search
MPPTVTGTVLDGIISGVLEDLHERQLMVTSDNLREATELVAPAIDPIPRLTAPGLSVISE
IKRSSPSNGQLAAIHDPAALADQYRSGGAAAISVLTEERRFQGSLADLDAVRAKVEIPVL
RKDFVVAEYQVLEARAHGADLILLIVAALSDDDLQRLYDLAIELGMTPLVEVHTPEEVSR
ATALGARVVGVNARNLKTLEVDKTIFRELLGELPENVVKVAESGILCVDEAVEVYDLGAD
AVLVGEMLVRHGEPAQVLRKIHRATV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccactgttaccggaacggtccttgacggaatcatttccggtgttctcgaagat
cttcatgagcgccaactcatggttacctcggacaatcttcgtgaggccactgagctcgtg
gcccctgctatcgatccgatcccgaggctgacagcgcctggcctgtcggttatctcagaa
atcaagcggtcgagcccgtcaaacggccagctggctgctattcatgaccctgccgcactg
gctgatcagtaccgctccggtggagccgctgctatcagcgttctgactgaggagcgccga
tttcaaggatccctggccgaccttgacgcggtgcgtgcgaaagttgagatcccagtactc
cgcaaggatttcgttgtcgcggaataccaggtgctcgaagcccgtgcacacggggcagac
cttatcctcctcatcgttgccgcgttatctgacgacgacttgcaacgcctatatgacctt
gccatcgagctgggcatgaccccgctagttgaagttcatacccctgaagaggtaagtcga
gctacagcccttggtgcccgtgtggtgggtgtgaatgcgcgcaacctcaagaccctcgaa
gtcgataagaccattttcagggaactccttggtgagctgcctgaaaacgtcgttaaggtg
gcggaatccggaattctttgcgtggacgaggccgtcgaggtatatgaccttggtgctgac
gcggtgttggtgggggagatgctggtccgccacggtgaaccagcacaagtattgcgcaag
atccaccgtgccaccgtgtga

DBGET integrated database retrieval system