KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_05725Help
Entry
TIA2EST36_05725   CDS       T01655                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pax03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1235420..1236025
Genome map
AA seq 201 aa AA seqDB search
MISHFSGMVSAAGPTWVVLDNHGVGIKVLCPPATAASARINQDMSLHTSLVVREESLTLY
GFVEADDRDAFELVQTASGVGPKLAAAIMSVLDAAQLATAITEEDDATLCRVPGIGRKGA
AKMILELKDKVAALTPRGASVSGATHVVAPWREQVAEGLVGLGWSAKDAEKAVDKVAALK
EADPAMTIGNLMRAALRSLAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccatttttccggcatggttagtgccgctggcccgacgtgggtcgtccttgac
aatcatggggttggtatcaaggtgctgtgccctcctgccacagctgcgagtgctcgcatc
aaccaagatatgtccctgcacacctccctggttgtgagagaggagtccctgactctttac
gggttcgtcgaagctgatgatcgcgatgcttttgagctggtgcaaaccgcgtcgggagtc
ggtcccaaattagctgcagcgattatgagtgtccttgatgctgctcagctagccacggcg
ataaccgaagaagatgacgcaactctatgccgcgttcccggaattggtcgcaagggtgcg
gcgaaaatgatcctggagctcaaggacaaggtcgcagcccttaccccacgtggagcttcg
gtgagcggagcgacccatgtggtcgcaccgtggcgggaacaggtggcggaagggctggtc
ggcttgggctggtcggctaaagacgcggagaaggccgtcgacaaggtggctgctctcaag
gaagccgatccagctatgaccatcggcaacctcatgcgagcggcattgcgtagtttggcg
cggtga

DBGET integrated database retrieval system