KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_05890Help
Entry
TIA2EST36_05890   CDS       T01655                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TIA2EST36_05890
Enzymes [BR:pax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TIA2EST36_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1272075..1272674
Genome map
AA seq 199 aa AA seqDB search
MSSVPVIPQARGLRHTGPVTVAVVSGPTAVGKGTVVGALLRSHPEIVVSRSVTTRPPRPT
ERDGIDYDFITPEQFDKLVDGEGLLEWATVHNSHRYGTPRGPVERAVADNRTVVLEIDLQ
GARQVRETYPQATQIFLAPPSWEELVHRLIGRGTETPEQQKQRLETAKVELANADEFDAV
VVNDTVDHAVAHLVELLSL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtccccgtcatccctcaggcccgagggcttcgtcacaccggcccggtcacc
gtggctgtcgtctccggacctaccgcagttggtaaagggaccgtggtaggggcgctgctg
cgtagccatccggagatcgtcgtttccaggtcggtgactacccgtccgccgcgccccact
gaacgcgatgggatcgattacgacttcatcacccctgagcagttcgacaagctcgttgac
ggcgagggtctccttgagtgggcaaccgtccataacagccaccggtacggcacaccgcgc
ggtcctgttgaacgggcagttgctgacaatcgcacggtcgtgctggaaatcgatctgcag
ggagctcgccaagttcgcgaaacctatcctcaggcgacccagatcttcctcgcgccaccc
tcatgggaggagctagtccaccgtctgatcggtcgcggcacggaaacaccagagcaacag
aagcagcgtctggagactgcaaaggttgagctggccaacgcggatgaatttgacgccgtt
gtcgtcaacgacaccgtagatcacgcagttgcgcatctggtagaattactaagtctgtga

DBGET integrated database retrieval system