KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_06800Help
Entry
TIA2EST36_06800   CDS       T01655                                 

Definition
(GenBank) pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
pax  Cutibacterium acnes TypeIA2 P.acn31
Pathway
pax00240  Pyrimidine metabolism
pax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TIA2EST36_06800
Enzymes [BR:pax01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     TIA2EST36_06800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N DUF2254
Motif
Other DBs
NCBI-ProteinID: AEW83944
Position
1465754..1467043
Genome map
AA seq 429 aa AA seqDB search
MTSTYSVVDLIRAKREGQTLNSDQIAWLIRAYTDDIVADEQMSAMAMAVYFQGLDDAELS
AWTTAMIKSGERMSFAGLSRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGH
TGGTLDKMEAIPGWRADLSHDEMVAQLEKVGAVICAAGPGLAPADKKLYALRDVTGTVES
IPLIASSIMSKKIAEGTDSLVLDVKTGSGAFMKTDKDARELASRLVELGEAAGVRTTALL
THMDVPLGYACGNGIEVAESLEVLAGGGPADVVELTVALARHMVKVAGLDGIDPADVLAS
GQAMDVWRNMVRAQGGDPDAPLPMAHHTQDIVATEAGVITGIDAMSVGLAAWRLGAGRAR
KEDPVQAAAGIMLRVRPGDRVVTGQPLATLLTDTPDSIARAEDAMTNAFTVGQTFQPQDI
VIDTVVAQS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcacctattccgtcgtcgaccttatccgcgctaagcgcgaaggccagactctc
aactccgaccaaatcgcatggcttatccgcgcctacaccgacgacatcgtcgccgacgag
cagatgtctgccatggcgatggcggtgtacttccaggggctcgacgacgctgagctgtca
gcctggacgacggccatgatcaagtcgggcgagcggatgtccttcgctgggctgtcccgc
cccactgtcgacaagcactccactggcggcgtgggcgacaaaattaccttgccgctggct
cccctggtggccgcgtgcggtgctgccgtcccacagctgtctgggcgtggcctgggccac
accggaggcaccctcgacaagatggaggccattcccggatggcgggcggatctctctcat
gacgagatggtcgcccagctcgagaaagtcggcgccgtcatctgcgcagcgggcccggga
ctagcccctgctgacaagaagctctacgccctgcgcgacgttaccggcaccgtcgagtcc
atcccgctgatcgcttcgtccatcatgagcaagaagatcgcagagggcaccgacagcctc
gtcctcgatgtcaagaccggctcgggtgccttcatgaagacagataaggacgcccgcgaa
ctcgccagccgtctcgtcgagctaggtgaagccgccggggtgcgtaccaccgccctactg
acccacatggacgtcccactgggttacgcctgcggtaacggcatcgaggttgccgaatcc
ctcgaggtgttagccggcggaggtcctgccgacgtcgtcgagctcaccgtcgccctggcc
cgtcacatggtgaaggtggctggattggacggcatcgacccggccgatgtactcgccagt
ggccaggcaatggatgtctggcgcaacatggttcgtgcccagggcggcgaccctgacgct
ccactaccgatggcccaccacacccaggacatcgtcgccaccgaggctggcgtcatcacc
gggattgatgccatgtccgttggcctagctgcctggcgtttgggtgccggacgcgcccgc
aaagaggatccggtgcaagctgcggctggtatcatgttaagagttcgccccggcgaccgc
gttgtcacaggccagccattggccaccctgctcaccgacacccccgactccattgcgcgg
gccgaggatgccatgaccaacgcgttcaccgtcgggcaaaccttccagccgcaagacatt
gtcatcgacaccgtcgtagcccagtcgtga

DBGET integrated database retrieval system