KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_07220Help
Entry
TIA2EST36_07220   CDS       T01655                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pax03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1543029..1543799)
Genome map
AA seq 256 aa AA seqDB search
MPELPEVETVRAGLEQFVVPVVVDSVDVVDTRGLRPSGGLEDAALFETTLSGRQFTAVNR
RGKYLWFILDDGTAMLAHLGMSGQFRVSTQHAPQHRHTRIVITLDDGRDLRFLDQRTFGG
LTLAPLVDGIPGPVTHIAPDPFEECFDVDEVVRRLCARRSAIKRSLLDQTLVSGIGNIYA
DETLWRVRCHPETPCSRLSQSEAVELLQTACDVMAEAMSQGGTSFDSLYVNVNGESGWFS
RVLDAYGREDEPLPPM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagctccccgaggtcgagaccgttcgagccggactcgaacagttcgttgttccg
gttgtcgtcgacagcgtcgacgttgtcgatactcgcgggcttcgccccagcggtggactc
gaggacgctgcgcttttcgagacgaccttgtcgggtcgtcaatttactgccgtaaatcgc
cggggtaagtacctgtggttcatccttgacgatggcaccgcgatgttggctcatctaggt
atgagcggacaattccgtgttagcacccaacatgccccgcagcatcgccatacccgtata
gtcatcaccctcgacgatggtcgtgacctgcgcttcctcgaccagcgcaccttcggcgga
ttgaccctagccccgctcgttgatggtattcccggtccggtgacccacatcgcccctgat
ccgttcgaggagtgtttcgacgttgacgaggtagtgcgacggttgtgcgcacgcaggtcc
gccattaagaggagtttgctcgatcaaacccttgtttccgggattggcaatatctatgcc
gacgaaactctttggcgggtccgttgtcaccccgagacaccatgctctcgcctgagtcaa
tccgaagcggtggaattgttgcagacggcctgcgatgttatggcagaggccatgtctcag
ggcggtacctctttcgactctctttatgtcaacgtcaacggggaatcggggtggttttcc
cgtgttttggatgcctacggccgtgaggatgagcccctgccaccgatgtga

DBGET integrated database retrieval system