KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_07555Help
Entry
TIA2EST36_07555   CDS       T01655                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pax00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1616639..1617862)
Genome map
AA seq 407 aa AA seqDB search
MKKVIILGSTGSIGTQTLEVISSRRDQFEVAGISAGGSDVGSLAQQIIDFSIPVVAVARE
DAAEELQRALAVQAGSRGRIVPNPRILTGPDASTELAAMPADVVCNAITGAAGLRPTLAT
LAAGTTLALANKESLVIGGRLVTQAAASGQIVPVDSEHSAFAQCLRGGGRNEVRRLVLTA
SGGPFRGRDRASLADVSAAEAMKHPTWNMGRVITINSSTLVNKGLELLEAALLYDVDLDD
ITVVVHPQSIVHSMVEFWDGATIAQASPPDMRLPIALGLSWPDRLPDAAAGCDWSTATQW
TFEPLDNDTFGAVELARRAGHAAGTAPAVFNAANESCVDAFCAGSIGFLDITDTIAAVLD
EHLSGDENDTLGARHVGDEALTLDAVLAADAWGRRRAAEVCARGIRR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaggtcatcattctcggctccaccggatcgatcggaacccaaactctagaggtc
atttcgtcacgtcgtgaccagtttgaggtcgctggcatatcggcaggtggctcggatgtt
ggctcactagctcagcagataatcgacttctctatccccgtcgtagctgtcgctcgtgag
gatgccgctgaggagcttcagcgggctttggccgtgcaggctggatcacggggccgtatc
gtgcccaatcctcggatccttactggcccggatgcgtcgacagagctggcagctatgccc
gctgatgttgtctgtaatgccattaccggcgcggctggtttgcgaccgaccctcgccacc
ttggccgcagggaccactttggccttagcgaacaaggagtcgttggtcattggtggcagg
ctcgttactcaggcggccgcctcaggacagattgtccccgtggattctgagcactccgcc
ttcgcccagtgcctacgagggggcgggcgcaacgaggtgcgtcgccttgttctgaccgca
tccggcggacctttccgcggtcgcgaccgtgcctccctggccgatgtcagcgctgccgag
gccatgaagcatcccacctggaatatgggccgggtcatcaccattaactcgtcgactctg
gtgaataagggtttggagctgctcgaggcggccctactttatgatgttgatctcgacgac
atcaccgtcgtcgtccatcctcaatccatcgtccactcgatggtggagttctgggatggc
gccactattgctcaggcttcgcctcccgacatgagattgccgattgccttgggactgtct
tggccggatcgccttcctgacgcagctgccggctgcgactggtcgacggctactcagtgg
accttcgaaccccttgacaacgacactttcggggccgtcgaactagcccgacgcgctggt
catgctgcgggtactgcgccggccgtgttcaatgccgctaacgagtcctgtgtcgacgcc
ttctgtgccggaagtatcggtttcctcgacattaccgacaccattgccgcggtccttgac
gagcacctatccggtgacgagaacgacacccttggtgctcgacatgtcggtgacgaggcc
ctcaccctcgatgccgtgttggccgccgacgcctggggtcgtcgtcgcgccgccgaggtg
tgtgcccgggggattcgccggtga

DBGET integrated database retrieval system