KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_08180Help
Entry
TIA2EST36_08180   CDS       T01655                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pax00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pax00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1777711..1778181)
Genome map
AA seq 156 aa AA seqDB search
MKVVAIAAVADNGVIGSGQDMLWHISEDFRRFKTVTMGHTLIFGRRTFEQIGKLPGRRHI
ICTRDPHWSHEGVDVATSPRQAVEMAREAGEEICFVAGGGQIYADAFELCDELDITEVHQ
NPNGAARFPAIDPEVWVEVRRESRDGFDFVGYRRRA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgtcgctatcgccgccgttgctgataacggcgtcatcgggtcggggcaggat
atgctctggcacattagtgaggatttccgtcgttttaagactgtgacgatgggtcacaca
ttgatctttgggcgtcgtacctttgaacagatcggcaagcttcctgggcgtcgtcacatc
atctgcacccgcgacccgcactggtcccatgagggggtggacgtcgcaaccagcccgcgt
caggccgtcgagatggcgcgtgaggcaggcgaggagatctgttttgttgccggaggtgga
cagatctacgccgacgctttcgagttgtgcgacgagctcgacatcaccgaagtccaccag
aatccgaatggtgcggcgcgtttccccgccattgaccctgaggtgtgggtggaggttcgt
cgtgagtctcgtgacggcttcgatttcgtcgggtaccgacgccgggcatga

DBGET integrated database retrieval system