KEGG   Cutibacterium acnes TypeIA2 P.acn31: TIA2EST36_10145Help
Entry
TIA2EST36_10145   CDS       T01655                                 

Definition
(GenBank) biotin-requiring enzyme
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pax  Cutibacterium acnes TypeIA2 P.acn31
Pathway
pax00010  Glycolysis / Gluconeogenesis
pax00020  Citrate cycle (TCA cycle)
pax00620  Pyruvate metabolism
pax01100  Metabolic pathways
pax01110  Biosynthesis of secondary metabolites
pax01120  Microbial metabolism in diverse environments
pax01130  Biosynthesis of antibiotics
pax01200  Carbon metabolism
Module
pax_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST36_10145
   00020 Citrate cycle (TCA cycle)
    TIA2EST36_10145
   00620 Pyruvate metabolism
    TIA2EST36_10145
Enzymes [BR:pax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TIA2EST36_10145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H HlyD_D23 DUF3248
Motif
Other DBs
NCBI-ProteinID: AEW84592
Position
complement(2204986..2206395)
Genome map
AA seq 469 aa AA seqDB search
MPDPGEGLTEGEVVSWRVSPGDTVKINDVLCEVETAKSIVELPSPFAGTVAKLCAEPGET
VAVGEPLVTIDDGSDDQPEEEPEFLVGHLTAESGRRRRRRRGAAVSAERAPEKAPQTPTL
KTGPETDVEPVPEPVQPTQPRRQDPPRMDRAGHVLAKPPARRVAADLGIDLSTVTGTGPQ
GAVTRSDVKAAAEAGRQAAPEPPVVGASAGDAEFATLSVMSRRLLGGAPTEPDGHTRRVP
VRGVRKVTAKAMKDSLDTKALVTAFLTCDVTPTMDLVARLRADRRFKGLRVSPLTIWCKA
VCLAMGRTPVVNARWDDAADQIVFRDQINLGIAAATPRGLMVPVVRNAQDMTMLELAEEI
TRIVAIAKEGKLQPTDYTDGTFSITNVGVFGLDAGTPVVNRTESAILVLGTIARRPWVVG
TGDDEEVVPRWVTTMSLGFDHRLIDGEEGSTFLHDVAEILSDPASAMLY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacccgggcgaagggctcaccgagggagaggtcgtctcctggcgggtgtctccc
ggtgacaccgtcaagatcaacgacgtgctgtgcgaggtcgagacggccaagtcgatcgtc
gaactccccagccctttcgccgggaccgtggcgaagctgtgtgccgagcccggcgagacg
gtggctgtgggagagccactggtgaccattgacgacggttccgacgaccaacccgaggag
gagccggagttcctcgtcggtcacctgaccgcggagtccggacgtcgacgccgtcgtcgc
aggggagctgcggtgtcggctgaaagggcacccgagaaggccccccagacgccgaccctc
aagaccggtccagagactgatgtcgagcccgttcccgaacctgtgcagccgacacagccc
aggcgccaggatccgccgcgcatggaccgcgccgggcatgtcctcgccaagcccccggcc
cgacgtgtggctgccgacctcggcatcgacctctcgacggtgacgggcaccggcccgcag
ggggcggtgacgaggagcgacgtcaaggcggcagcggaggccggtcgtcaagccgcgcct
gaaccacctgtcgtcggtgcctctgctggcgacgctgagttcgcgaccctgtcggtgatg
tctcgtcgtctcctcggcggtgccccgaccgagcctgacggccacactcgcagggtcccg
gtgcgcggcgtccgcaaagtgactgccaaggcgatgaaggattccctggacaccaaggcc
ctcgtgacggccttcctcacctgcgacgtcaccccgacgatggacctcgtcgcccggctg
cgtgccgaccgcaggttcaagggactgcgcgtctccccgctgaccatctggtgcaaggcg
gtgtgcctggcgatgggacgcaccccggtcgtcaacgcccgctgggacgacgccgccgac
cagatcgtcttccgcgaccagatcaacctcggcatcgccgcggccaccccgcgcggcctc
atggtgcccgtggtgcgcaacgcccaggacatgacgatgctcgagctggccgaggagatc
acccgcatcgtcgccatcgccaaggagggaaagctccagcccaccgactacaccgacggc
accttctcgatcaccaatgttggggtgtttggccttgacgcagggactccggtcgtcaac
cgcaccgaatcggcgatcctcgttctcgggacgatcgctcgacgtccgtgggtcgtcggg
accggtgacgatgaggaggtcgtgcccaggtgggtgacgacgatgagcctcggcttcgac
catcgcctcattgacggcgaggagggctcgaccttcctccatgacgttgcggagattctc
tcggacccggcctcggcaatgctgtactga

DBGET integrated database retrieval system