KEGG   Cutibacterium acnes TypeIA2 P.acn31: TIA2EST36_10330Help
Entry
TIA2EST36_10330   CDS       T01655                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
pax  Cutibacterium acnes TypeIA2 P.acn31
Pathway
pax00010  Glycolysis / Gluconeogenesis
pax00520  Amino sugar and nucleotide sugar metabolism
pax01100  Metabolic pathways
pax01110  Biosynthesis of secondary metabolites
pax01120  Microbial metabolism in diverse environments
pax01130  Biosynthesis of antibiotics
pax01200  Carbon metabolism
Module
pax_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pax_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST36_10330
   00520 Amino sugar and nucleotide sugar metabolism
    TIA2EST36_10330
Enzymes [BR:pax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     TIA2EST36_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK bPH_2
Motif
Other DBs
NCBI-ProteinID: AEW84624
Position
2237457..2238539
Genome map
AA seq 360 aa AA seqDB search
MFTWTVSVVPHARSQSVRLSQGPIQRKLGLADIDVHTSSGPVTVSCPHLDAMDAQVFAVG
QMDPPVPPVAGNCHPSLPRTNHLPLRLSTMNKVLGIDVGGSGIKGAPVDLEVGDFAEPRL
RIPTPEKSSPENIVTVLREIVDNFAPTIGDGPVGISFPAPARHGVIPFIANLDQGWAGLH
AEKYISDALGRPVTVLNDADAAGVGEVHYGAARGVPGVVVLTTLGTGIGSAVINNGILLP
NTELGHLEIDGHDAEKRAASSVKDRKHMSYKDWATKRLQRYYEVVEMLFSPDLFVVGGGI
SKDHKKFFKYLKLETPMVPAQLLNRAGIIGAAWQAQWRLEHPDATEEEVVKAAKKAKDAD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttgtttacctggaccgtcagcgtcgttcctcatgctcggtcgcagtcggtaagactgtcc
caggggccgatacaacgcaaactcggcttggctgatatcgacgtgcatacctcgtctggc
ccagtgacggtttcctgtccccacctcgacgccatggacgcccaggtcttcgccgtcggt
cagatggatccgcccgtgccgcccgtggccgggaactgtcacccgagtctcccccgcacc
aaccatctaccgttacgcttgtccaccatgaacaaggtgctgggaattgacgttggtggt
tccgggatcaagggagccccggttgacctcgaggtcggagactttgccgaaccgaggctt
cgcattcccaccccggagaagtcgtcccccgagaacatcgttaccgtgctgcgtgagatc
gtcgacaatttcgcccccaccatcggtgacgggccggttggcatctctttccccgccccg
gcacgccacggcgtcattcccttcatcgctaacctcgatcagggttgggccggcctgcac
gccgagaaatatattagtgacgctctcggccgcccagtgaccgttcttaacgacgccgac
gccgcaggtgtgggcgaggtccactacggcgctgcgaggggagtacctggcgttgtcgtt
ctcaccactctgggcaccggcatcggctctgccgtcatcaataacggcatcctgctgccg
aacaccgagcttgggcacctcgagattgatggtcacgacgccgagaagcgcgctgcctcc
tcggttaaggatcgcaagcacatgtcttacaaggactgggcaaccaagcgtctgcagcgt
tactacgaggtcgtcgagatgctcttttcccccgatctctttgtcgtcggtggcggtatc
tctaaggaccataagaagttcttcaagtacctcaagctcgagacgccgatggtgcccgcc
cagttgttgaatcgagctggcatcatcggtgcggcctggcaggcccagtggcgtctagag
catcctgacgccaccgaggaagaggtcgtcaaagctgccaagaaggcgaaggacgctgac
tga

DBGET integrated database retrieval system