KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_10545Help
Entry
TIA2EST36_10545   CDS       T01655                                 

Definition
glycosyl hydrolase family 3 N-terminal domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TIA2EST36_10545
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TIA2EST36_10545
Enzymes [BR:pax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TIA2EST36_10545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2281971..2283860)
Genome map
AA seq 629 aa AA seqDB search
MKRRTVMAAAAGAFAASALPLSRAAADDTRSQLASMTLDQKIGQVLWTHVFGASADDASM
ARKNQLAFGDDVRTPAQAVQKYHLGGVLYFNWSGNISTPTNPAAVAHLSNGLQEAARTSS
TAPLAIAVDQEGGIVARITSPATEFPGNMALGAVNDPRAARAQGAVLGRELAALGINVDF
APDVDVNTNPANPVIGVRSMGDDPVRVGVLGVEQIRGIQSRGVAATAKHFPGHGDTQIDS
HLGLPVVEYGRTTLERHLVPFRMAISAEVDMIMTAHIIVKTLDPTMPATLSKKVLTGLLR
EQMGYRGIITTDALDMEGAQLAVMTEDEKGTYTRLKAAADAEGNDPTAADEGHASAEFNA
FMKPIRGRVAVQAFEAGSDILLNPHDADAVVTAMRRAIADGRVSERRLDESVLRILSWKR
RRCITGRPVDLAAADREVRSGRKVADDIAARSVTMLVNDGTLPLKPSRVLVTGTRRGNPE
YLVEPLRLAGFTPILVPSTGQEPTTADVEKAVTVGVDAVIVVTHGLKRGDAQDAMVKALA
RTGNPVVEIMTGTPYDVAMTHRPHAALAVYSNRKVSMVAAVAMMAGRNPVGRLPVRVPDP
NGGTAFPRGFGLSYRATPGPYEGPGAKTA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgacgcactgtcatggccgccgcggctggagcctttgcggcatcagcccttccg
ctgtcgcgagcggcagcggatgacacccggtctcagctcgcctccatgaccttggaccag
aagatcggtcaagtgctatggacccatgtcttcggtgccagcgctgacgacgcttcaatg
gcgaggaagaatcagctggcctttggcgatgacgtccgcactccggcccaggccgtgcag
aagtaccaccttggcggggtgctgtacttcaactggtccggtaacatctcgacgcccacg
aatccggccgccgtcgcccacctttccaacggcctgcaagaggcggcgaggacgtcgtcg
acggcgccgttggccatcgctgtcgatcaggagggcggtatcgtcgcgcggattacctcc
ccggccaccgaatttccagggaatatggcgctgggtgctgtcaatgacccgcgcgctgcg
cgtgcccaaggcgcggtgctcggtcgcgagctggctgccctgggcattaacgtggacttc
gccccggacgttgacgtcaacactaacccagccaatcccgtaatcggggtgaggtccatg
ggggacgatccggtgcgcgtcggggtactcggcgtcgagcagattcgcggcattcaatcc
agaggggttgcggccaccgccaagcatttcccaggtcatggtgatacccagatcgactcc
catcttggtcttccggtcgtggagtacggtcgcactaccctggagcgtcacctggtgccc
ttccgcatggcgatcagcgcggaagtggacatgatcatgacagcccacatcatcgttaag
accttggacccgacgatgccggccaccctgtcgaagaaagtgcttactggcctgctgcgc
gaacagatggggtatcgcggcatcatcaccaccgacgccctggacatggagggtgcccag
cttgcggtcatgaccgaggacgagaagggcacgtataccaggctcaaggctgctgccgac
gccgagggcaatgaccccacggcggccgatgaggggcatgcgagtgccgagttcaacgcc
tttatgaaaccgatccgggggcgtgttgcggtgcaggctttcgaagccggatccgacatt
ttgctgaacccccatgacgctgatgccgtcgtcacagcgatgcggagggctatcgcggac
ggtcgggttagcgagcggcgtctcgacgaatcggtgctgcgcatcctctcttggaagcgg
cgtcgctgcattacgggcaggccggttgacctcgcggcggccgatcgtgaggtacgatct
ggccgcaaggttgctgacgacatcgctgccaggtcggtgacgatgctggtcaatgacggc
actctgccgctcaagccgtcacgggtgctcgtcaccggaacacgtcggggtaatccggag
tacctcgtcgagccgttgcgcttggccggattcaccccgattcttgttccgtcaaccgga
caggaaccgacgacagccgatgtcgagaaagcggtgactgtcggtgttgatgccgtcatc
gtggtcacgcacgggttgaaacgtggagatgcccaggacgccatggttaaggctctggcg
cggaccgggaatccggtcgtggagattatgacagggaccccgtacgacgtggcgatgact
catcgcccgcatgccgcactagctgtctactccaaccgcaaggtgagcatggttgcggct
gtcgcgatgatggctggacgaaacccggtggggcgacttccggtacgggtgcccgacccg
aacggaggcacagcttttccgcgcggtttcgggctcagctaccgcgcgacgcccggaccc
tatgagggcccgggcgcgaagactgcttga

DBGET integrated database retrieval system