KEGG   Photorhabdus asymbiotica: PAU_00062Help
Entry
PAU_00062         CDS       T00941                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00010  Glycolysis / Gluconeogenesis
pay00620  Pyruvate metabolism
pay00640  Propanoate metabolism
pay00680  Methane metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01130  Biosynthesis of antibiotics
pay01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAU_00062 (acs)
   00620 Pyruvate metabolism
    PAU_00062 (acs)
   00640 Propanoate metabolism
    PAU_00062 (acs)
  Energy metabolism
   00680 Methane metabolism
    PAU_00062 (acs)
Enzymes [BR:pay01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PAU_00062 (acs)
Lipid biosynthesis proteins [BR:pay01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PAU_00062 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAQ82155
UniProt: C7BTZ3
Position
complement(63794..65749)
Genome map
AA seq 651 aa AA seqDB search
MTQIMKYPIPAIIAEHTLMNKQQYQQNYQLSLQDPEKFWGDKGKIVDWIKPYTKVKNTSF
DPGHINIRWFEDGTLNLSANCLDRHLKERGDQTAIIWEGDDPTESKTVTYRELHHDVCQF
ANVLKNLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFAGFSPDAVSGRIIDSNT
KLVITADEGLRAGRTIPLKKNVDDALSNTAVVSVSNVIVFKRTGNINNWHSGRDLWWHEL
TAGVSADCPVEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASLTFKYVFDYHPGEI
YWCTADVGWVTGHSYLLYGPLSCGAITLMFEGVPNYPAANRLSQVIDKHQVNILYTAPTA
IRALMAEGDKAIEGTKRTSLRIMGSVGEPINPEAWEWYYQKIGNKQCPIVDTWWQTETGG
FMITPLPGATELKAGSATLPFFGVQPALVDNLGELLEGACEGNLVITDSWPGQARSLFGD
HDRFEQTYFSAFKGMYFSGDGARRDEDGYYWITGRVDDVLNISGHRLGTAEIESALVSHP
KIAEAAVVGVPHNIKGQAIYAYVTLIHGEEPSPQLYTEVRNWVRKEIGPIATPDILHWTD
SLPKTRSGKIMRRILRKIASGDISNLGDTSTLADPGVVEKLLEEKQTMNIS
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaataatgaaatatcccattcctgcaatcattgcagaacacaccttgatgaat
aaacaacaatatcaacagaattaccaattatcgctgcaagatcccgaaaaattttggggt
gataaaggtaaaattgttgactggattaaaccttacactaaagtaaagaatacctctttt
gaccccggacatatcaatatccgctggttcgaagatggaacgctaaatctcagtgcaaat
tgtcttgatcgtcatttaaaagagcgtggtgatcaaaccgctattatttgggaaggtgat
gatccaacagaatccaaaactgtaacctatcgagaactgcatcatgacgtatgccagttt
gctaatgtactgaaaaatctcggtattaaaaaaggtgatgtggttgctatttatatgccg
atggtaccagaagctgcggttgctatgttggcatgtgcccgcattggtgctatccactct
gttattttcgcaggtttttctcctgatgcagtatctggacgtattattgattcaaatacc
aaattggtcatcaccgctgatgaaggcttgagagcaggacgtaccattcccctgaaaaag
aatgtcgatgatgcattaagtaacacagccgttgtcagtgtttccaatgtgattgttttc
aaacgcactggaaatattaataactggcactctggccgtgacctttggtggcatgaatta
acagcaggcgttagtgctgactgtcccgttgaagaaatgaatgcagaagacccgctgttt
attctctatacctccggctctaccggtaaacctaaaggcgtactgcacactaccggggga
taccttgtatatgcatccctgacctttaaatatgtattcgattatcatccgggcgaaatc
tactggtgtacagctgacgtgggttgggttaccgggcatagttatcttctctacggacca
ctttcctgtggcgctattactctgatgtttgaaggtgtaccaaactatcctgctgctaat
cgtttaagccaggttattgacaaacatcaggttaatatcctgtacacagcaccaacagcg
attcgtgctctgatggctgaaggggacaaagccatcgaaggaacaaaacggacttcccta
cgtatcatgggatcagttggtgaacctattaacccggaagcatgggaatggtattaccag
aagattggtaataagcaatgtccgattgttgatacctggtggcagacagaaaccggtggt
ttcatgataacgccgctacctggggcaaccgagctaaaagcaggttccgcaactttacct
ttcttcggtgttcaaccagcattggttgataatcttggcgagctattagaaggtgcttgt
gaaggaaatctggttattactgactcctggccaggacaagcgcgctcattgtttggcgat
catgatcgcttcgaacaaacctatttctccgcctttaaagggatgtactttagtggtgac
ggagcacgtcgtgatgaagacggctattattggataactggccgtgttgacgatgtgtta
aatatctctggtcatcgtttaggtaccgctgaaattgaatctgctttggtttcccatccc
aaaattgcagaagccgctgttgtaggtgttccacataacatcaagggacaagcaatttat
gcctatgtcacgttaattcacggcgaggaaccatctccccagttatataccgaagtccgt
aattgggtacgtaaagaaatcggcccgatcgctacaccagatatcctgcactggacagac
tccttaccaaaaacccgctcaggaaaaattatgcgccgtatcctgcgtaaaattgcttcc
ggcgatattagtaatttaggagatacctccacattggcagatccaggagtagtagaaaaa
ctattggaagaaaaacaaacaatgaatatctcgtga

DBGET integrated database retrieval system