KEGG   Photorhabdus asymbiotica: PAU_00069Help
Entry
PAU_00069         CDS       T00941                                 

Gene name
dam
Definition
DNA adenine methylase (deoxyadenosyl-methyltransferase (dna adenine methyltransferase) (EC:2.1.1.72)
Orthology
K06223  
DNA adenine methylase [EC:2.1.1.72]
Organism
pay  Photorhabdus asymbiotica
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:pay00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    PAU_00069 (dam)
Enzymes [BR:pay01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     PAU_00069 (dam)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(71330..72142)
Genome map
AA seq 270 aa AA seqDB search
MKKKRAFLKWAGGKYPLVDDIKRHLPAGSCLIEPFVGAGSVFLNTDYDSYILADINSDLI
NLYNTVKFRANEFIAHTRPLFTQEYNSAEHFYQLREQFNQSTDPFHRSVLFLYLNRHCYN
GLCRYNSHGKFNVPFGRYKKPYFPEEELYWFAEKAQNATFICEHYQYTLDKAHKGSVIYC
DPPYAPLSATANFTAYHTNSFNITDQENLAHIAFKLSSERAIPVLISNHDTPMTRKWYYQ
ASLHIVKARRTISRNILARSKVDELLALYR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaacgcgctttcttgaaatgggccggtggaaaatacccgttggtagatgat
atcaaacgtcatttgccagccggtagttgtctgatagagccatttgttggcgcaggttct
gtctttctgaacacagactacgattcttacatcctcgctgatatcaacagtgaccttatt
aacctatacaacacagtaaaattcagggcgaatgagtttatagctcatacccgccctctg
tttacccaagaatacaactcagccgagcatttttatcagttacgggaacaatttaaccaa
agtaccgacccgttccaccgcagcgtgttattcctttacctcaatcgccattgttacaac
ggcctctgccgttataattctcatggtaaatttaacgtaccttttggccgctataaaaaa
ccctattttcccgaagaagaattatattggttcgctgaaaaagcgcaaaatgcgactttt
atttgtgagcactatcaatacacgttggacaaagcacataaaggctcagttatctattgc
gacccgccttatgctcctttatcagcaaccgcaaactttacggcgtaccacaccaacagt
tttaacattaccgatcaggaaaatctggcacatattgcatttaagttatcatcagaacgt
gcaattcctgttttgatatccaatcacgatacgccaatgacacgaaaatggtactatcag
gcttcacttcatattgtcaaagcacgtcgcactattagcaggaatatccttgctcgcagt
aaagtagacgaactgttggcattatatcgctga

DBGET integrated database retrieval system