KEGG   Photorhabdus asymbiotica: PAU_00211Help
Entry
PAU_00211         CDS       T00941                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00230  Purine metabolism
pay01100  Metabolic pathways
Module
pay_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PAU_00211 (gmk)
Enzymes [BR:pay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PAU_00211 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 RsgA_GTPase AAA_16 ABC_tran AAA_22 MMR_HSR1 Viral_helicase1 CPT AAA_29 Dynamin_N Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: CAQ82304
UniProt: C7BHD6
Position
complement(228936..229559)
Genome map
AA seq 207 aa AA seqDB search
MIQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRAMRPGENHGEHYFFITEQ
AFRQMIDNNEFLEHARVFGNYYGTSRKVIEETLASGVDVFLDIDWQGAQQIRKQMPSARS
IFILPPSKEELCRRLRGRGQDSEDIIEKRMEQAVAEMVHYNEYDYLIVNDDFNTALADLH
TIIRSERLHRERQAQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaggtacgttatatattgtctctgcgccaagcggagcgggtaaatcaagcctg
attcaggctttgttaaaaactcaacctttgtatgatactcaggtttctgtttctcatacc
acgcgtgcaatgcgccccggtgagaatcatggtgagcactatttttttatcacggaacaa
gcttttcgccagatgatcgataataacgaatttctggaacacgcccgtgtttttggtaat
tattacggtacatcccggaaagtgatcgaagaaactcttgccagtggggttgatgttttt
cttgatatcgattggcaaggagcacagcagatccgcaaacaaatgccatctgcccgtagc
atttttatcctgccgccgtcaaaagaggagctttgtcgccgtctgcgcggccgaggtcag
gacagtgaagatattattgaaaaacgtatggaacaagcggttgcagaaatggttcactat
aacgagtatgattatttaatcgttaatgatgatttcaatacggcattggccgatctgcac
accatcatccgttcagaacgcctgcatcgggagcgccaggcacaacggcatgatgcttta
atcagcaaattattggcagactga

DBGET integrated database retrieval system