KEGG   Photorhabdus asymbiotica: PAU_00371Help
Entry
PAU_00371         CDS       T00941                                 

Gene name
rocF
Definition
(GenBank) arginase/agmatinase/formimionoglutamate hydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00220  Arginine biosynthesis
pay00330  Arginine and proline metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01130  Biosynthesis of antibiotics
pay01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    PAU_00371 (rocF)
   00330 Arginine and proline metabolism
    PAU_00371 (rocF)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PAU_00371 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAQ82464
UniProt: C7BIA6
Position
403759..404637
Genome map
AA seq 292 aa AA seqDB search
MTNRSNTIRLVMPQWQGGNNPAYRFGAEMLNWLAPETDVPVIHVPVLGPASPLSVENGII
GREALKTQLNSVWKIIHEYQPDNIVMFGGDCLVDLAPFAWLSERWGEKLGILWIDSHPDV
MTPAQFQYAHAHVLGALMGNGDPDLTTTVARPVSSQRVMIAGIHSPLEYEKKFIADNAIR
TCSPEEVRAGGAAVMQWIEEEKIECLAIHIDLDVLDYHNFRSVLFARPGACEHDFDGIAK
GKLNIPDVLTLVQKAASRAKVVGVGIAEHLPWDAMNLKDMLEQLPLIGRSGS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgactaaccgctcaaatactatcagattggtgatgccacagtggcaggggggaaataac
ccggcatacagatttggtgcagaaatgttgaactggcttgcaccggaaacggatgtacct
gttattcatgtacctgtccttggacctgccagtcccctttcggtagaaaatggcatcatc
ggtagggaagcactaaaaactcagctgaatagcgtctggaaaattattcacgaatatcag
ccagataatatcgtcatgtttggtggtgattgtcttgtcgatctcgcaccttttgcttgg
ttgagtgagagatggggagagaagctagggatactgtggattgattcacatccggatgtt
atgactcccgctcaatttcagtacgctcacgctcatgttcttggcgcactgatggggaat
ggtgatcctgatctgacaactacagtggcccgcccggtatcttcccagagagttatgatc
gcaggaatacacagtccgctggaatatgagaaaaaatttattgctgataacgcaatcaga
acctgttctccggaggaggttagagcaggaggcgcggcagtgatgcagtggattgaagaa
gaaaaaatcgaatgtctggcaattcatattgatttggatgtattggactaccataacttc
cgttctgtgttgtttgcccgtccgggggcctgtgagcatgatttcgatggtatcgcaaaa
ggtaaacttaacattcccgatgtgctaactctggtccagaaggcagcctctcgggctaaa
gttgttggggttgggattgcagaacaccttccctgggatgctatgaatcttaaagatatg
cttgaacagcttcctttaatagggcgttctggtagttga

DBGET integrated database retrieval system