KEGG   Photorhabdus asymbiotica: PAU_00371Help
Entry
PAU_00371         CDS       T00941                                 

Gene name
rocF
Definition
arginase/agmatinase/formimionoglutamate hydrolase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pay  Photorhabdus asymbiotica
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pay01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pay00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403759..404637
Genome map
AA seq 292 aa AA seqDB search
MTNRSNTIRLVMPQWQGGNNPAYRFGAEMLNWLAPETDVPVIHVPVLGPASPLSVENGII
GREALKTQLNSVWKIIHEYQPDNIVMFGGDCLVDLAPFAWLSERWGEKLGILWIDSHPDV
MTPAQFQYAHAHVLGALMGNGDPDLTTTVARPVSSQRVMIAGIHSPLEYEKKFIADNAIR
TCSPEEVRAGGAAVMQWIEEEKIECLAIHIDLDVLDYHNFRSVLFARPGACEHDFDGIAK
GKLNIPDVLTLVQKAASRAKVVGVGIAEHLPWDAMNLKDMLEQLPLIGRSGS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgactaaccgctcaaatactatcagattggtgatgccacagtggcaggggggaaataac
ccggcatacagatttggtgcagaaatgttgaactggcttgcaccggaaacggatgtacct
gttattcatgtacctgtccttggacctgccagtcccctttcggtagaaaatggcatcatc
ggtagggaagcactaaaaactcagctgaatagcgtctggaaaattattcacgaatatcag
ccagataatatcgtcatgtttggtggtgattgtcttgtcgatctcgcaccttttgcttgg
ttgagtgagagatggggagagaagctagggatactgtggattgattcacatccggatgtt
atgactcccgctcaatttcagtacgctcacgctcatgttcttggcgcactgatggggaat
ggtgatcctgatctgacaactacagtggcccgcccggtatcttcccagagagttatgatc
gcaggaatacacagtccgctggaatatgagaaaaaatttattgctgataacgcaatcaga
acctgttctccggaggaggttagagcaggaggcgcggcagtgatgcagtggattgaagaa
gaaaaaatcgaatgtctggcaattcatattgatttggatgtattggactaccataacttc
cgttctgtgttgtttgcccgtccgggggcctgtgagcatgatttcgatggtatcgcaaaa
ggtaaacttaacattcccgatgtgctaactctggtccagaaggcagcctctcgggctaaa
gttgttggggttgggattgcagaacaccttccctgggatgctatgaatcttaaagatatg
cttgaacagcttcctttaatagggcgttctggtagttga

DBGET integrated database retrieval system