KEGG   Photorhabdus asymbiotica: PAU_00480Help
Entry
PAU_00480         CDS       T00941                                 

Gene name
phoA
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pay  Photorhabdus asymbiotica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pay00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pay00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pay02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
544255..545697
Genome map
AA seq 480 aa AA seqDB search
MSQKYTKNLMAVMISALISGGSLPVLAVGDQGANQIMMEERAVKGNITEFGGARRMTHNQ
TEALKAAINNNKAKNVILFIGDGMGDSEITIARNYAEGAGGFFKGIDALPFTGQYTHYSL
NKGTHKPNYVTDSAASATAWATGIKTYNGALAVDVFGKDHQTLLELAKANGKGTGNVTTA
RVQDATPAALYAHVTGRDCYGPKETTKECPTNALENGGRGSITEQLLVARADVTLGGGAK
IFTQKSVAGDRKGKTLEEQALEQGYQLVRDAKSLASINEANQKKPLLGLFHEGNMDIAWE
GPKAVYHGNIDNPPVSCKVNSKRNPNAPTLAQMTEKAIDLLKENKNGFFLQVESGSIDKQ
DHKANPCGQIGETVVLDEAVQVGLKYAREHGDTLVIVTADHAHSSQIIEAGVKSPGLAQA
LVTKDGSVMAVSYSDSEGEEQEHTGAQLRVAAYGPQAANVVGLTDQTDLFFTIRSAMELK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaaaatatacaaaaaatttgatggcagtcatgatctcagccttaatttcaggg
ggcagcctaccggtactggcggttggtgatcagggggctaaccaaattatgatggaagag
cgtgcggtaaaaggcaatattactgaatttggtggtgctcgccgtatgactcacaatcag
actgaggcattgaaggctgcaattaataataataaagctaaaaatgttattttgtttatt
ggtgatgggatgggcgattctgaaattactatcgcccgtaactatgcagagggtgccggt
ggatttttcaaaggcattgatgctttaccatttactggacaatacacacactattctctc
aataaagggacccataaacctaactatgtgactgattctgcggcttctgctaccgcttgg
gctactggcataaaaacctataatggtgcattggctgttgatgtatttggtaaagatcac
caaactttacttgagctggcaaaagcgaatggcaaagggacaggcaatgtcacaacggct
agggtgcaggatgctacaccggctgcactgtatgcacatgtgaccggccgtgattgttat
ggtccgaaagagacgacaaaagaatgcccgacgaatgcgttggaaaatggcgggcgaggt
tctatcacagaacagctgttagtggctcgtgctgatgtgacattaggtggtggtgccaag
attttcacccagaaatctgttgctggagatagaaaaggtaaaacgctggaagaacaggcc
ctagaacagggctatcagctggtaagagatgctaaatcactggcatcaattaacgaagca
aatcagaaaaaaccgctattgggtctgttccatgaaggcaatatggatattgcctgggaa
ggacctaaagcggtttatcacggtaatattgataaccctccagtgagttgtaaagtgaac
tctaaacggaatcctaatgcgccaactttggcacagatgacagagaaagctatcgatctg
ttgaaagaaaataagaatggtttcttcctgcaagtagaaagtggctctattgataagcag
gatcacaaagctaacccttgtgggcagattggtgaaaccgttgtattggatgaagcggtt
caagttggcttgaagtatgcgcgtgagcacggtgatacattagtgattgtcacggctgat
catgctcactctagccagattattgaagcgggtgtgaagtctccaggactggctcaagca
ttggttaccaaagatggttcagtgatggcagtgagttacagtgattctgagggggaagag
caagaacatacaggggctcagctccgcgttgctgcttatggccctcaggcagcgaatgtt
gttggtttgactgaccagacagatctctttttcactatacgtagtgcgatggaattaaaa
tga

DBGET integrated database retrieval system