KEGG   Photorhabdus asymbiotica: PAU_00514Help
Entry
PAU_00514         CDS       T00941                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pay  Photorhabdus asymbiotica
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PAU_00514 (deoA)
Enzymes [BR:pay01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PAU_00514 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
574552..575877
Genome map
AA seq 441 aa AA seqDB search
MLLAQEIIRKKRDGYPLNEEEIRFFINGICEDTVSEGQIAALAMSIYFHDMTMEERVALT
LAMRDSGTVLNWKNLHLNGPIVDKHSTGGVGDVTSLMLGPMIAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDERFRKIIQDVGVAIIGQTHSLAPADKRFYATRDITATVDSI
PLITASILGKKLAEGLDALVMDVKVGSGAFMPTYEKSEQLAESIVSVANGAGCKATALLT
DMNQVLASSAGNALEVREAVRFLTGEYRNPRLLEVTMALCVEMLVSGNLVTGREDARNKL
QSVLDNGKAAEIFGRMIAAQQGPTDFVERYDRYLPTASFSKPVLAEQHGFITDMNTRALG
MSVVSLGGGRRKVVDLIDYSVGLSNIVALGSEVSADTPLAIIHANNENQWQEAAEAVRKA
IVLGAEAKPATPMVYRQISES
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttgttgctggcacaggaaatcatccgtaaaaagcgtgatgggtatccattgaatgaagaa
gagatccgcttcttcattaatggcatatgtgaggatactgtttccgaagggcaaattgct
gctctggcgatgtctatttacttccacgacatgacgatggaagagcgtgtggctttgaca
ttggctatgcgcgattccggtacggttttgaattggaaaaatttgcatctgaatggcccg
attgtggataaacactcgactggtggtgttggtgatgtcacttccctgatgcttggcccg
atgatagctgcctgtggcggttatgtgccgatgatctcaggccgtggtctgggccatacc
ggtggtacgctggacaaattagaagcgatccctggatttgatattttccctgatgacgag
cgttttcgtaaaattattcaggatgttggtgttgcgattatcggccaaactcattcgttg
gcaccggcagataaacgtttctatgctacccgtgatattaccgcaacggtggattctatt
cctttgatcacggcatctatcctgggtaaaaaactggctgaaggtttggatgctttggtg
atggatgtcaaagttggctcaggtgcgtttatgccgacttatgaaaaatcagagcaattg
gcagaatctattgttagtgtggctaatggtgcaggttgtaaagcgacagcactattgacg
gatatgaatcaggttctggcatccagtgcgggtaatgcgcttgaggttcgtgaagctgtt
cgctttctgaccggtgaatatcgtaatccacgtttactcgaagttacaatggcactctgt
gttgaaatgctggtatctggtaatctggtgacaggccgcgaagatgcccgtaataaactc
cagtctgtattagataacggtaaagcagcagaaatctttggtcgtatgatcgctgcccag
caaggtccgactgatttcgttgagcgttacgaccgttacttaccaacagcctcgttcagc
aagccggtattggctgaacagcatggatttatcactgatatgaatacccgtgctctgggt
atgtctgtggtttccctcggtggagggcgccgtaaagtagtggatctcattgattacagt
gtggggctgagcaatatcgttgctctggggtcagaagtgagtgcagatactcctttagct
atcattcatgccaataatgagaaccaatggcaggaagcggcagaggcagtacgtaaagct
atcgttctgggcgcagaagccaaaccagccacaccgatggtttatcgccaaattagcgaa
tcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system