KEGG   Photorhabdus asymbiotica: PAU_00546Help
Entry
PAU_00546         CDS       T00941                                 

Gene name
bglB
Definition
6-phospho-beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pay  Photorhabdus asymbiotica
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAU_00546 (bglB)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PAU_00546 (bglB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(614445..615878)
Genome map
AA seq 477 aa AA seqDB search
MRKTMKKQFPENFLWGGALAANQAEGAYQTGGKGLSISDMQPYGVIGGSMERNTDDFNIK
DISIDFYHRYPDDIALFAEMGFKCLRTSIAWTRIFPEGDEEVPNENGLAFYDRLFDEMRK
YHIQPLITLSHFEMPYGLVKKYGGWGNRKTIEFFERYARTVFERYKHKVKYWLTFNEINM
SLFSCFTGVGLPEDSEIQDIYQALHYQLVASAKAVKACHEIIPDAKIGNMVAATSYYPLT
CHPDDVLESLKKNRESLFFFDVQARGYYPSYMTRLFKEQNITLDITDEDQQALKETVDFL
SLSYYMSCCATTDPNMVKSAGNMINPVENPYLASSEWGWQIDPQGLRYLLNTLYDRYQMP
LFIVENGLGARDVIQDDGSIIDDYRIQYLNDHLFQVREAIEDGVQLLGYTSWGPIDLVSA
STAEMSKRYGFIYVDRDDQGNGTLERRRKKSFNWYKDVISSNGNILTAPGVKNENSQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaaccatgaaaaaacaatttccagaaaacttcctttggggtggtgcattagca
gcaaatcaggctgaaggagcctatcaaacaggtggaaaagggttatcaatctcagatatg
caaccctacggagttattggcggtagtatggagcgcaatacggatgattttaatatcaag
gatatcagcattgatttttatcaccgttatcctgacgatattgcactgtttgctgaaatg
ggatttaaatgcctaagaacatccatcgcctggacacgtatatttccggaaggagatgaa
gaagtaccaaatgaaaatggtctagctttttatgatcgcctttttgacgaaatgagaaaa
tatcatatccaaccattaattaccctttctcattttgaaatgccttacggcttagtaaaa
aaatacggtggttggggaaatcgtaaaacaattgaattctttgaacgttacgccagaacg
gtttttgaacgttacaaacataaggtaaaatattggctgacattcaatgaaattaacatg
tctttattttcttgctttaccggtgtagggttgccagaagacagtgaaattcaagatatt
tatcaagctttacattaccagctagttgccagtgccaaagccgttaaagcctgccatgaa
attattccagatgcaaaaattggtaatatggtggcagcaacatcttactatccattaacc
tgccatcctgatgatgtattagaatcattaaaaaagaacagagaatcgctgttctttttt
gatgttcaggctcgtggatattatccatcctatatgactcgcctatttaaagagcagaat
attacacttgatataaccgatgaagatcaacaagcattaaaagaaaccgttgatttcctt
tctctcagttattacatgagctgttgtgcaactacagatccaaatatggtcaaatccgcc
ggtaatatgattaatccggtagaaaatccttatctagccagttcagagtggggatggcaa
atagatcctcaggggctgcgttatcttctcaatacgttatatgaccgttaccaaatgcca
ttatttattgtagaaaatggtctgggcgcaagagatgttattcaagatgatggttctatt
attgatgattaccgaattcaatatctcaacgatcatttatttcaggtacgggaagccatt
gaagatggtgtgcagttattaggatatacctcatggggaccaatagatttagtcagcgct
tctacagcagaaatgtcaaaacgatacggatttatttatgtcgatcgtgatgaccaaggc
aatggaacactggagcgtcggcgtaagaaaagctttaactggtataaagatgttataagc
agtaacgggaatattcttacagcaccgggagtaaaaaatgaaaatagccaataa

DBGET integrated database retrieval system