KEGG   Photorhabdus asymbiotica: PAU_00564Help
Entry
PAU_00564         CDS       T00941                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00670  One carbon pool by folate
pay00790  Folate biosynthesis
pay01100  Metabolic pathways
Module
pay_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAU_00564 (folA)
   00670 One carbon pool by folate
    PAU_00564 (folA)
Enzymes [BR:pay01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PAU_00564 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CAQ82656
UniProt: C7BKH0
Position
636584..637069
Genome map
AA seq 161 aa AA seqDB search
MNISLIAALAMDRIIGMDKTMPWNLPGDLAWFKRNTLNKPVIMGRVTYESIGRPLPGRLN
IVLSNQPGDDERVTWVSSVDEALVVAGDAEEIMVIGGGKIYDQFISLANRMYLTHIDAEV
IGDTYFPDYEPDEWDSEFTEYHDADELNSHSYCFEILQRRT
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcagcttgatcgctgctttagctatggatcggatcatcggcatggataagaca
atgccgtggaatctgccgggggatctggcctggtttaaacgtaatacactgaataaacca
gtcattatggggcgagtaacttatgagtccattggtcgaccattacccgggagactcaat
attgtattgagtaaccaaccgggtgatgatgagcgtgtaacctgggtaagctcagttgat
gaagcactggttgtagcaggtgatgccgaagagattatggttataggaggcggtaaaatt
tatgaccaatttatctcattggctaaccgtatgtatctaactcatattgatgcagaggtg
ataggtgatacctattttcctgactatgaaccggatgaatgggattctgaatttactgaa
taccatgatgcagatgaattgaactctcatagctactgttttgagattttacaacgccgt
acctaa

DBGET integrated database retrieval system