KEGG   Photorhabdus asymbiotica: PAU_00592Help
Entry
PAU_00592         CDS       T00941                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pay  Photorhabdus asymbiotica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pay03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
673715..675571
Genome map
AA seq 618 aa AA seqDB search
MISLLQQAVDLRLLRSLDLQFAHALIGDENPALLLVMALLSAEAGAGHVCLPISRIMPEY
FFDGRQREFAEQLWQVAGKPDEQSLRAALESCAAVSDGFQPAPVVLSHNRLYLQRMWQSE
CQVAAFFSTNNQSTDSIQEEQLRTILDELFTLSDETMDWQKVAAAVAVTSRVSVISGGPG
TGKTTTVAKLLAALIKLNPDKNLVIRLAAPTGKAAARLTESLNSAVRKLSLTEKQFESMP
DQAQTIHRLLGAQPDSQQLRYDRDNPLSLDVLVVDEASMVDLPMMARLVDALPLYAKIVL
LGDRDQLASVEAGAVLGDVCRFVEMGYSAVRVEQLSRLTGCQLVAGEQENIPEVRDRLCL
LRRSYRFDVDSGIGQLAAAVNQGKSRQALSILQQPLNDICFYPLLDDEDYQRLLAETVLS
YRSYLQLVAKQAPAKEVLDEFNRYRLLCALREGPFGVSGLNERIEQLLHRQGLIRRPMGI
FSRGYAGRPIMISRNDSILGLFNGDIGIMLRDENSELRAYFQLPDGQIKGIQPSRLPQHE
TAYVMTVHKSQGSEFEHTALVLPTQFVPVVSRELVYTAMTRARKKLTLYTHDAVLRQAIQ
TPTQRRSGLAERLSRLVD
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgttattacaacaggcagtagatctcaggcttctgcgctcattggatttacag
ttcgctcatgcgttgattggggatgaaaatcctgctctgttgctggtgatggcgctatta
agtgctgaagctggtgctgggcatgtttgcctacctattagccggataatgcctgaatat
ttttttgatgggcggcagcgtgaatttgcagagcagttatggcaggtggcagggaaacct
gatgagcagagcttgcgtgcagcattagagagttgtgctgctgttagtgatggctttcag
ccagcacccgttgttctttcgcataaccgactttatttgcaaaggatgtggcaaagtgag
tgccaagttgctgcttttttctctaccaacaatcaatcaaccgatagtattcaggaagag
cagctgagaactattctggatgaattatttacgctatctgatgagacaatggactggcaa
aaggtggctgctgctgtagcggtaactagcagagtttcagttatctctggtgggccggga
accgggaaaacaacaactgttgcgaagttattggcagctttaatcaaacttaatcctgac
aaaaatctggtgatccgattggctgctccgacgggaaaagcagctgccagattgacagaa
tctcttaacagtgctgtcagaaagctttctctgacggagaaacagtttgaatctatgcca
gatcaggcccagacgattcaccgcttattaggggctcagccggatagtcagcagttacgt
tatgaccgagataacccattgagtttggatgttttggtggtagatgaagcttcaatggtg
gatttgcccatgatggctaggttggttgatgcgttaccgttatatgcaaaaattgttttg
cttggtgatcgtgatcaattggcgtcagtggaggctggagctgtattgggagatgtatgc
cgttttgttgagatgggatatagcgccgtgagagtggagcagctaagccgattgactgga
tgccagttagttgcaggcgagcaggagaatatcccggaagttcgtgatcgtttgtgcctt
ttacgcagaagttatcgttttgatgtagattcggggataggtcaacttgctgcggcagtt
aatcagggaaagagtcggcaagctctctctatcttgcaacagccattgaatgatatctgt
ttttacccattgcttgacgatgaagattatcagcggttactggctgaaacggtattgagt
tatcgctcttatttgcaactggttgcaaagcaagcaccggctaaagaggttttggatgaa
tttaaccgctatcgtttgttgtgtgcacttagagaagggccatttggtgttagtggactt
aatgagcgtatagaacagctattacatcgtcaggggcttattcgtcgccctatggggatt
tttagtcgtgggtatgcaggtcgaccaattatgatttcccgtaatgacagtatacttggc
ctgtttaatggtgatatcggtattatgctcagggatgaaaatagtgaactacgtgcttat
tttcaactaccagatggacagattaaaggaattcaaccaagccgtttaccacagcatgaa
acagcatatgtgatgactgtacataaatcgcagggatcagaatttgaacatacggctctg
gtactgccaacgcagtttgtaccggttgttagccgagaactggtctatacagcgatgact
agggctagaaagaagctaacgctttatacacatgatgcggtattgcgtcaggccattcaa
acgcccactcaaaggcgtagtgggttggctgaacgtcttagccggctggtggattag

DBGET integrated database retrieval system