KEGG   Photorhabdus asymbiotica: PAU_00648Help
Entry
PAU_00648         CDS       T00941                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-d-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00900  Terpenoid backbone biosynthesis
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01130  Biosynthesis of antibiotics
Module
pay_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PAU_00648 (dxr)
Enzymes [BR:pay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PAU_00648 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CAQ82740
UniProt: C7BL94
Position
733758..734954
Genome map
AA seq 398 aa AA seqDB search
MKRLTILGSTGSIGKSTLAVVRNNPEKFEVTALAAGKNVQVMVEQCLEFQPQYAAMIDES
SAKELSQLLIEQGCKTEVLFGEQAACDLAALNDVDQVMSAIVGVAGLLPTLAAIRAGKQI
LLANKESLITSGRFFMDAVVKYNAQLLPIDSEHNAIFQSLPEVIQQNLGREELKQHGIAS
IILTGSGGPFRHTSLEQLPFVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEACCLFN
ASAAEMEVVIHPQSVIHSMVRYLDGSVIAQLGTPDMCTPISYAMAYPERISSGVKPLDFC
SLGTLSFSKPDYERYPCLKLAIEACHEGQAATTALNAANEEIVKVFLQNGISFTDIAIIN
RQVVEKLNLPEPQSIEEVLQIDKFARDLAIKTISSFIR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggttgaccatccttggttccacgggttctataggcaaaagtacactcgctgta
gttcgcaataatcctgagaaatttgaagtaacggcactggctgccgggaaaaatgttcag
gttatggttgagcaatgtctggaatttcagcctcaatacgcggcaatgatagatgaatct
tccgcaaaagagcttagtcagttactgattgaacaaggttgtaaaaccgaggtacttttc
ggggaacaggctgcatgtgatttggctgctttgaatgatgttgatcaggttatgtctgcg
attgtcggggttgccggtctattgccgacgttagctgctatccgggcgggtaaacagatt
ttacttgctaataaagaatcgttgatcaccagtggtcggttttttatggatgctgtagtg
aagtacaatgctcaattgttacctatcgacagtgagcataatgctatttttcagagttta
cctgaggtaatacaacaaaatcttgggcgcgaagaactgaaacaacacggtattgctagt
attattctgaccggatctggcgggccttttcgccatacgtctttggaacagttgcccttt
gttacaccagatcaagcatgtgctcacccgaattggtcgatggggcgcaagatttctgta
gattccgcaacaatgatgaataaaggtttggaatacattgaagcctgttgtttgttcaat
gcctctgctgctgaaatggaagtggtgattcatccccaatctgtcattcattctatggtc
cgttatctggatggtagcgttattgctcagttgggaactccggatatgtgtacaccgatc
tcctatgcaatggcatacccagaacgtatttcttctggtgttaaacctcttgatttttgc
tctctaggtacattgagtttttcgaaaccagattatgagcgatatccatgcctgaagctg
gctattgaagcatgccacgaaggtcaggctgcaactacggcgttgaatgcggcaaatgaa
gaaatcgttaaggtttttttacaaaatggaatctctttcacagatattgcgattataaat
cggcaggttgtagaaaaactgaatttaccggaacctcagagtattgaagaagtcttacag
attgataagttcgcgagagatttggcgataaagactatcagttcgtttatcaggtag

DBGET integrated database retrieval system