KEGG   Photorhabdus asymbiotica: PAU_00702Help
Entry
PAU_00702         CDS       T00941                                 

Gene name
fucI
Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
pay  Photorhabdus asymbiotica
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PAU_00702 (fucI)
Enzymes [BR:pay01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     PAU_00702 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(799477..801255)
Genome map
AA seq 592 aa AA seqDB search
MKKHMNLPKIGIRPVIDGRRLGVRESLEEQTMNMAKATANLLTQHICHTCGTPVECVIAD
SCIAGLAESAACDEKFSTLNVGLTVTVTPCWCYGSETVDMVPTRPKAIWGFNGTERPGAV
YLAAALAAHAQKGIPAFSIYGHEVQDTDDPHIPDDVKEKLLRFARAGLAVASMKGKTYLA
VGGVSMGIAGSIVDHNFFESWLGMKVQSVDMTELRRRIDKQIYDEEELELALSWADKYFQ
YGEDLNAEQYRRSPENHRQILRESLLMAICIRDMMQGNPTLKVKGYSEEALGYNAIVAGF
QGQRHWTDQYPNGDMAEAILNSSFDWNGIRQPLMIATENDSLNGIAMLFGHLLTGTAQIF
ADVRTFWSPESVERVTGQKLTGPAENGVIHLINSGSATLDGTCCQKDEQGHPTMKPHWEI
TEEEMNACLAATQWYPAIHEYFRGGGFSSKFLTKGGVPFTMSRVNMIKGLGPVLQIAEGW
SAELPKDIHDVLDKRTNETWPTTWFVPRLTGKGAFKDVYSVMANWGANHGVLSIGHVGAD
FITLAAMLRIPVCMHNVDEKAIYRPASWSAHGMDPEGSDYRACQNYGPLYKQ
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcatatgaatctacctaagattggtattcgcccagttattgatggtcgtcgt
ctgggggtacgtgaatcactcgaagagcaaaccatgaatatggcaaaagcgacagctaat
ttattaactcaacatatttgccatacttgtggtacccctgttgaatgcgttattgccgat
tcgtgcattgccggtcttgctgaatctgccgcttgtgatgaaaaattcagcacattaaat
gttggtctaaccgtgactgtcacaccatgttggtgttatggcagtgaaacagtagatatg
gtaccaaccagaccgaaagctatctggggttttaatgggactgaacgtcccggtgcagtc
tatcttgccgcagctttagcggctcacgcgcaaaaaggtatccccgctttttctatatac
ggacatgaagttcaagatactgatgacccgcacattcctgatgatgttaaagaaaaattg
ctacgatttgcacgggctggattagctgttgccagtatgaaaggaaaaacttatctcgct
gttggcggtgtctcaatgggcatcgcaggctcaattgttgatcataacttttttgaatcc
tggcttggtatgaaagtccaatctgttgatatgactgaattacgccgtcggattgataag
caaatatatgatgaagaggaacttgaactcgctttatcttgggcagataagtattttcaa
tatggtgaagacctgaatgctgaacaatatcgccgttcaccagaaaatcatcgtcaaatt
ctgcgcgaaagtctacttatggctatctgtattcgtgacatgatgcaaggaaatccaaca
ctgaaagttaaagggtacagcgaagaagctctcggctacaatgcgattgtcgcaggcttc
cagggacaacgtcactggacagatcaataccctaatggcgatatggcagaagccatttta
aatagttcattcgactggaacggcattcgtcagccattgatgattgcaacagaaaatgac
agtctaaatggcattgcgatgttatttggtcatctgttaacaggcacagcccagattttt
gctgatgttcgcactttttggtctccagaatctgttgaacgtgtcacgggtcaaaaactt
acgggaccggcagaaaatggggtgatccatctcattaattcaggttctgcaacattggat
ggaacctgttgtcaaaaagacgagcagggtcaccctacaatgaaacctcactgggaaatt
accgaagaggaaatgaatgcctgtctggctgcaacgcaatggtatccagcaatccatgaa
tatttcagaggtggaggattctcctccaaattcttaacgaaagggggcgttcctttcacc
atgagtcgggtcaatatgattaaaggtcttggtcctgtcctgcaaatagctgaaggctgg
agtgcagaattgcccaaagatattcacgacgttctggataaacgcaccaatgaaacctgg
cccacaacctggtttgttccacggttaaccggtaaaggcgcctttaaagacgtctattct
gttatggcgaattggggagctaatcacggcgtactttctattggtcatgttggcgcagac
ttcattacattagcagcaatgctaagaatcccagtttgtatgcataacgtggatgaaaaa
gccatttatcgtcctgcttcatggagtgcgcatggtatggaccctgaaggttcagattac
cgagcctgccaaaactatggccctctctataagcaataa

DBGET integrated database retrieval system