KEGG   Photorhabdus asymbiotica: PAU_00704Help
Entry
PAU_00704         CDS       T00941                                 

Gene name
fucA
Definition
l-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pay  Photorhabdus asymbiotica
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pay00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
802999..803646
Genome map
AA seq 215 aa AA seqDB search
MKRNTLSREIIDTCLEMTRLGLNQGTAGNVSVRYKNGMLITPTGIPYEQLTEAHIVYVDE
NGQHEDHKIPSSEWRFHQAVYHARPDANAVIHNHAIHCVAVSILNKSIPAIHYMIAAAGG
DSIPCVPYATFGTKQLSDYVFDGFKDRKAILLQHHGMIACEVNLQKALWLAHEVEILARL
YLQTLVIQNPVPVLSQEEIAIVLEKFKTYGLKIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaatacattatctcgagaaattattgatacatgtttagaaatgacccgactc
ggattgaatcaaggcacggcaggtaatgtcagtgtccgttataaaaatggcatgttaatt
actccgacagggataccttatgaacaattgactgaagcacatattgtctatgtagatgaa
aatggtcaacacgaggaccataagattccctctagtgaatggcgttttcatcaggcggtc
taccatgccagacccgatgcaaatgcagttatccataatcatgcaattcattgcgtcgcg
gtttctattttaaataaatctatcccggctattcattatatgattgcggcggcgggaggc
gattctattccctgtgtaccttatgcaacatttggtactaaacaactctctgactatgta
tttgatgggtttaaagatagaaaagccattttattacagcatcatgggatgatcgcttgt
gaggttaatttacaaaaagcactgtggcttgcacatgaagttgaaatactcgctcgcctg
tatttacaaaccctagtgatccaaaatccagtccctgttctgagtcaagaggaaatagcg
attgtgcttgagaaatttaagacatatggcttaaaaattgaagaatga

DBGET integrated database retrieval system