KEGG   Photorhabdus asymbiotica: PAU_00742Help
Entry
PAU_00742         CDS       T00941                                 

Gene name
gene0005
Definition
putative aerobic formate dehydrogenase-o subunit
Orthology
K00127  
formate dehydrogenase subunit gamma
Organism
pay  Photorhabdus asymbiotica
Pathway
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAU_00742 (gene0005)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PAU_00742 (gene0005)
  Energy metabolism
   00680 Methane metabolism
    PAU_00742 (gene0005)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(840600..841238)
Genome map
AA seq 212 aa AA seqDB search
MKKKDTILRHSPIERVNHWAVVLCFLFTGISGLGFFFPSFNWLMNILGTPQLARILHPFI
GSVMFFLFTFMFVRYFKHNFIDKEDIVWLKNIRKIIRNEEAGDIGQYNLGQKGIYWSISI
CLILLAMSGVIIWRPYFADFFSIPLIRLALLVHSLAGVGLILLILIHAYAAFWVKGSIRA
MVEGWVTRGWAKKHHPRWYREIRQKEQQEKKP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaagatactattctccgccactcaccgattgagcgagtaaatcactgggcg
gtcgtactctgttttctatttaccgggatcagtgggttaggattcttcttcccatccttt
aactggttgatgaatatcttaggtacgccccagttagcccggatactgcatccgtttatc
ggttcagtgatgtttttcttatttacctttatgtttgtcagatatttcaaacataacttt
atcgacaaagaggacattgtttggctgaaaaacattcgtaaaatcatcaggaatgaagaa
gctggcgatatcggtcagtacaatcttggtcagaaagggatctactggtctattagcatc
tgtctaatcttactggcaatgagtggcgtgattatctggcgtccctatttcgctgatttt
ttctccatcccgttgatccggcttgcgcttttggtccactctctggctggcgttggcctg
atcctgctgattctgatacatgcctatgccgcgttttgggtgaaaggatctatcagagca
atggttgaaggctgggtaactcgcggttgggcgaagaaacatcatcctcgctggtataga
gaaattcgtcagaaagagcagcaggagaaaaaaccttaa

DBGET integrated database retrieval system