KEGG   Photorhabdus asymbiotica: PAU_00807Help
Entry
PAU_00807         CDS       T00941                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pay  Photorhabdus asymbiotica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pay00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(907723..908238)
Genome map
AA seq 171 aa AA seqDB search
MARVYIALGSNLAKPVQQVKNALAALKELPETEFITCSSMYRTKPMGPQDQPDFLNAVVA
LETTLAPEELLNHTQAIELAQGRVRKNERWGPRTLDLDIMLFGDQVINTERLTIPHYGLK
QREFMLYPLAEIAPDLVFPDGEALSERLKHIPENGLALWLQLQPSEPNNCL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtgtttatatcgcgcttggtagtaatttggcgaaacccgttcagcaagtaaaa
aacgcgcttgctgcattaaaagaattaccagaaacagagtttattacctgttcctcgatg
tatcgtaccaaacctatggggccacaggatcaacctgactttctgaatgcggtggtagca
ctggaaaccactctagcaccggaagaattactcaatcacactcaagcgattgaattggct
caaggacgagtaagaaaaaatgagcgctgggggccaaggacacttgatctggatatcatg
ctatttggtgatcaggtcattaataccgaacgcttgacgattccccactatggattaaaa
cagcgcgaattcatgctttatccgttggctgaaatcgcccctgacctcgttttccctgat
ggtgaagctttatctgaaagactgaaacacatcccagaaaacggcctggcactctggcta
caactacagccctctgagcccaataattgcctataa

DBGET integrated database retrieval system