KEGG   Photorhabdus asymbiotica: PAU_01089Help
Entry
PAU_01089         CDS       T00941                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pay  Photorhabdus asymbiotica
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PAU_01089 (speB)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PAU_01089 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1236266..1237192
Genome map
AA seq 308 aa AA seqDB search
MTISTLGNQQDNSLVSNAFGFLRFPLNFQPYSSDAEWVITGVPFDMATSGRSGSRHGPAA
IRQVSTNLAWESRRWPWDFKLRNYLNVVDCGDLVFDFGDAQDMSDKLQDHAERLLSSGKR
MLSFGGDHFITLPLLRAHAKYFGKMALVHFDAHADTYPNGSKFDHGTMFYHAPNEGLIDP
HHSVQIGIRTEHGQDDGFTVLDAAQVNDRSVEDLIAQIKETAGDMPVYLTFDIDCLDPAF
APGTGTPVIGGLTTDRTLKLLRGLQPLNIVGMDVVEVAPAYDQSEITALAGATVALEMLY
LQAAKKII
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacaataagtaccttgggcaaccaacaagataactccctggtttcgaatgccttcggt
ttcctgcgctttccgctgaacttccagccgtattctagcgatgcagagtgggtaattacc
ggagtgccatttgatatggcaacatcaggtcgttcaggcagtcgccatgggccggcagct
atccgtcaggtttccactaacctggcttgggaaagccgccgctggccgtgggattttaaa
ttacgcaattacctcaatgtggtggattgtggtgatttagtcttcgattttggtgatgct
caggatatgagcgataaattacaggaccatgcggaaagattgttgtcttccggtaagcgc
atgctttcttttgggggtgatcatttcattactttgcctcttttacgcgctcatgctaaa
tattttggcaaaatggctctggtccattttgatgctcatgctgatacctatccaaacggc
agtaaatttgaccatggtactatgttttaccatgctccaaacgaaggattgatcgaccca
catcattcagtacagattggtatccgtactgaacatggtcaggacgatggtttcaccgtg
ttggatgctgctcaggttaatgaccgcagtgtggaggatttgatcgctcagataaaagag
acggctggcgacatgccggtttatctaactttcgatatcgattgtcttgatcctgctttt
gcaccaggtacgggtacgcctgttattggtggactgacaacagatcggacactgaagtta
ctgcgtggtttgcaaccactgaatattgtcggtatggatgtggtagaagtggctccagct
tatgatcagtctgagattactgctttggcaggtgcgaccgttgcactggagatgctttac
ttacaggctgctaagaaaataatctga

DBGET integrated database retrieval system