KEGG   Photorhabdus asymbiotica: PAU_01139Help
Entry
PAU_01139         CDS       T00941                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenas complex (e2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00010  Glycolysis / Gluconeogenesis
pay00020  Citrate cycle (TCA cycle)
pay00620  Pyruvate metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01130  Biosynthesis of antibiotics
pay01200  Carbon metabolism
Module
pay_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAU_01139 (aceF)
   00020 Citrate cycle (TCA cycle)
    PAU_01139 (aceF)
   00620 Pyruvate metabolism
    PAU_01139 (aceF)
Enzymes [BR:pay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PAU_01139 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: CAQ83231
UniProt: C7BQ52
Position
1292282..1293874
Genome map
AA seq 530 aa AA seqDB search
MAIEIKVPDIGADEVEVTEIMVKVGDTVEVEQSLITVEGDKASMEVPSPQAGVVKEIKVA
VGNKVETGKLIMIFDSADGVVEAAPAEESAVMSLSSRMAEPESVASAAMDVHVPDIGGDE
VEVTEVMVQIGDTVTAEQSLITVEGDKASMEVPAPFAGIVKDIKIKVGDKVKTDSMIMVF
EVAGAAPAPVASAPAPAAEPEKVVPVIESRSFVEADKNDFAENNAYVHATPVIRRLAREF
GVNLAKVKGTGRKGRILREDVQAYVKDAVKRAESAPASAGGGLPGMLPWPKVDFSKFGEI
EEVELGRIQKISGANLSRNWVMIPHVTQFDETDITEVENFRKQQNQEADKKQLGVKITPL
VFIMKAVAKALEEMPRFNSSISEDGQKLTLKKYINIGVAVDTPNGLVVPVFRDVNKKGII
ELSRELTEMSKKARAGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSRSSM
KPVWNGKEFVPRLMLPLSLSFDHRVIDGADGARFITFINHAMSDIRRLVM
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaattaaggtaccggatatcggtgcagatgaagttgaagtcaccgaaatc
atggtgaaagttggcgatacagtggaagttgaacaatcgctaatcacagtcgaaggtgat
aaggcttcgatggaagtcccatcccctcaagcgggtgttgttaaagagatcaaagttgcg
gttggtaataaagttgaaactggcaaattgattatgatttttgattctgctgatggtgtt
gtagaagctgcaccagctgaagaatcagccgttatgtcactatcttctcgtatggcagag
ccggaatcagtggcttctgcggctatggatgttcatgtaccggatatcggcggtgatgaa
gttgaagtaaccgaagtgatggttcaaatcggcgatacagttacagcggagcagtcactg
attaccgtggaaggtgataaggcttcaatggaagtgcctgcaccattcgccggtatcgtt
aaagacattaaaatcaaagtcggtgataaagtaaaaaccgattctatgattatggtattt
gaagtcgcgggtgcagcgcctgctcctgtggcttctgctccagcgccagcggctgaacca
gaaaaagtggtgcccgttatagagagcagaagtttcgtagaagcagataaaaacgacttc
gcagaaaataatgcttatgttcatgcaacaccggttatccgtcgtctggcccgtgaattt
ggtgttaacctggctaaggtgaaaggtacgggtcgtaaaggtcgtattctgcgtgaagac
gttcaggcttacgtgaaagacgcggttaaacgtgctgaatcggctcctgcgtcagctggt
ggtggtctaccgggtatgttgccttggccgaaagttgatttcagcaaatttggtgaaatt
gaagaagttgaactgggccgtattcagaaaatctctggtgctaacctgagccgtaactgg
gtgatgatcccgcatgttacgcagttcgatgaaacggatatcactgaagttgaaaacttc
cgtaaacagcagaatcaggaagctgataagaaacagcttggtgtgaagatcaccccgctg
gtattcatcatgaaagcggtagcaaaagcgctggaagagatgccgcgctttaacagctct
atctcggaagatggccagaaactgacgctgaaaaaatacatcaacattggtgtggcagtt
gatacacctaatggtctggtggttccagtgttccgtgacgttaataagaaaggcatcatc
gaattgtcccgtgagctgactgaaatgtctaagaaagcgcgtgctggcaaactgactgca
tctgatatgcagggtggatgcttcactatctcaagcttgggcggtatcggcggcacagca
tttacgccaatcgtcaatgcgccggaagtggctatcctgggtgtatctcgctcatcgatg
aagccagtctggaatggtaaagaatttgtaccacgcctgatgctgcctctgtcactttcc
ttcgaccatcgagtgatcgatggggctgatggtgcacgtttcattacatttattaatcat
gcaatgagcgatatccgccgtctggtgatgtaa

DBGET integrated database retrieval system