KEGG   Photorhabdus asymbiotica: PAU_01139Help
Entry
PAU_01139         CDS       T00941                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenas complex (e2) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pay  Photorhabdus asymbiotica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAU_01139 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAU_01139 (aceF)
   00020 Citrate cycle (TCA cycle)
    PAU_01139 (aceF)
   00620 Pyruvate metabolism
    PAU_01139 (aceF)
Enzymes [BR:pay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PAU_01139 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1292282..1293874
Genome map
AA seq 530 aa AA seqDB search
MAIEIKVPDIGADEVEVTEIMVKVGDTVEVEQSLITVEGDKASMEVPSPQAGVVKEIKVA
VGNKVETGKLIMIFDSADGVVEAAPAEESAVMSLSSRMAEPESVASAAMDVHVPDIGGDE
VEVTEVMVQIGDTVTAEQSLITVEGDKASMEVPAPFAGIVKDIKIKVGDKVKTDSMIMVF
EVAGAAPAPVASAPAPAAEPEKVVPVIESRSFVEADKNDFAENNAYVHATPVIRRLAREF
GVNLAKVKGTGRKGRILREDVQAYVKDAVKRAESAPASAGGGLPGMLPWPKVDFSKFGEI
EEVELGRIQKISGANLSRNWVMIPHVTQFDETDITEVENFRKQQNQEADKKQLGVKITPL
VFIMKAVAKALEEMPRFNSSISEDGQKLTLKKYINIGVAVDTPNGLVVPVFRDVNKKGII
ELSRELTEMSKKARAGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSRSSM
KPVWNGKEFVPRLMLPLSLSFDHRVIDGADGARFITFINHAMSDIRRLVM
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaattaaggtaccggatatcggtgcagatgaagttgaagtcaccgaaatc
atggtgaaagttggcgatacagtggaagttgaacaatcgctaatcacagtcgaaggtgat
aaggcttcgatggaagtcccatcccctcaagcgggtgttgttaaagagatcaaagttgcg
gttggtaataaagttgaaactggcaaattgattatgatttttgattctgctgatggtgtt
gtagaagctgcaccagctgaagaatcagccgttatgtcactatcttctcgtatggcagag
ccggaatcagtggcttctgcggctatggatgttcatgtaccggatatcggcggtgatgaa
gttgaagtaaccgaagtgatggttcaaatcggcgatacagttacagcggagcagtcactg
attaccgtggaaggtgataaggcttcaatggaagtgcctgcaccattcgccggtatcgtt
aaagacattaaaatcaaagtcggtgataaagtaaaaaccgattctatgattatggtattt
gaagtcgcgggtgcagcgcctgctcctgtggcttctgctccagcgccagcggctgaacca
gaaaaagtggtgcccgttatagagagcagaagtttcgtagaagcagataaaaacgacttc
gcagaaaataatgcttatgttcatgcaacaccggttatccgtcgtctggcccgtgaattt
ggtgttaacctggctaaggtgaaaggtacgggtcgtaaaggtcgtattctgcgtgaagac
gttcaggcttacgtgaaagacgcggttaaacgtgctgaatcggctcctgcgtcagctggt
ggtggtctaccgggtatgttgccttggccgaaagttgatttcagcaaatttggtgaaatt
gaagaagttgaactgggccgtattcagaaaatctctggtgctaacctgagccgtaactgg
gtgatgatcccgcatgttacgcagttcgatgaaacggatatcactgaagttgaaaacttc
cgtaaacagcagaatcaggaagctgataagaaacagcttggtgtgaagatcaccccgctg
gtattcatcatgaaagcggtagcaaaagcgctggaagagatgccgcgctttaacagctct
atctcggaagatggccagaaactgacgctgaaaaaatacatcaacattggtgtggcagtt
gatacacctaatggtctggtggttccagtgttccgtgacgttaataagaaaggcatcatc
gaattgtcccgtgagctgactgaaatgtctaagaaagcgcgtgctggcaaactgactgca
tctgatatgcagggtggatgcttcactatctcaagcttgggcggtatcggcggcacagca
tttacgccaatcgtcaatgcgccggaagtggctatcctgggtgtatctcgctcatcgatg
aagccagtctggaatggtaaagaatttgtaccacgcctgatgctgcctctgtcactttcc
ttcgaccatcgagtgatcgatggggctgatggtgcacgtttcattacatttattaatcat
gcaatgagcgatatccgccgtctggtgatgtaa

DBGET integrated database retrieval system