KEGG   Photorhabdus asymbiotica: PAU_01212Help
Entry
PAU_01212         CDS       T00941                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein dsbc precursor
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pay  Photorhabdus asymbiotica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1386322..1387023
Genome map
AA seq 233 aa AA seqDB search
MKKSVLCFSLLLTLISGNALADDGAIHGTMQKLGIKVESIKPSPIVGLNTIVTEQGIIYL
SDDGKYLLQGPIYDVSGSSPVNVSNQLLMKKLEAMKDQMIVYKAPEEKHVVTVFTDITCG
YCHKLHENMKEYNKLGITVRYLAFPRQGMKHKSAEEMQSIWCSATPQKSLDAAFKGNDIS
PIKGCKVNIANHYKLGLQFGVQGTPAIILKDGNLLGGYMPPEALAKTLDQSGK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagcgtgttatgtttttctcttttgctgaccttaattagcggaaatgcactg
gctgatgatggcgctattcatggaacaatgcaaaaattggggatcaaggtagaaagtatc
aaaccatcacctattgttggtttaaatacgatagtcaccgagcaaggtatcatttattta
tctgatgacggcaagtatttattgcaagggccaatttacgacgtcagtggtagttctcca
gtgaatgtcagtaatcaattattaatgaaaaagctggaagcgatgaaagaccaaatgatt
gtctacaaagcgccagaagaaaagcatgttgtgactgttttcacggatattacatgtggt
tactgccataaattgcatgaaaatatgaaagaatacaataaattggggattactgttcgc
tatttggcattccctcgccagggcatgaagcataagtctgctgaagagatgcaatctatt
tggtgtagtgcgacgccacagaaatcactggatgctgcgtttaaaggtaatgatatttcg
ccaattaaaggctgtaaggtgaatatcgctaaccattataaattggggctccagtttggc
gtgcagggaacgccggcgattatccttaaagatggcaacttattaggtggatatatgcca
ccagaagcgttggcaaagacattagatcagagtggtaaataa

DBGET integrated database retrieval system