KEGG   Photorhabdus asymbiotica: PAU_01212Help
Entry
PAU_01212         CDS       T00941                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein dsbc precursor
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pay  Photorhabdus asymbiotica
Brite
Enzymes [BR:pay01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PAU_01212 (dsbC)
Secretion system [BR:pay02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PAU_01212 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1386322..1387023
Genome map
AA seq 233 aa AA seqDB search
MKKSVLCFSLLLTLISGNALADDGAIHGTMQKLGIKVESIKPSPIVGLNTIVTEQGIIYL
SDDGKYLLQGPIYDVSGSSPVNVSNQLLMKKLEAMKDQMIVYKAPEEKHVVTVFTDITCG
YCHKLHENMKEYNKLGITVRYLAFPRQGMKHKSAEEMQSIWCSATPQKSLDAAFKGNDIS
PIKGCKVNIANHYKLGLQFGVQGTPAIILKDGNLLGGYMPPEALAKTLDQSGK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagcgtgttatgtttttctcttttgctgaccttaattagcggaaatgcactg
gctgatgatggcgctattcatggaacaatgcaaaaattggggatcaaggtagaaagtatc
aaaccatcacctattgttggtttaaatacgatagtcaccgagcaaggtatcatttattta
tctgatgacggcaagtatttattgcaagggccaatttacgacgtcagtggtagttctcca
gtgaatgtcagtaatcaattattaatgaaaaagctggaagcgatgaaagaccaaatgatt
gtctacaaagcgccagaagaaaagcatgttgtgactgttttcacggatattacatgtggt
tactgccataaattgcatgaaaatatgaaagaatacaataaattggggattactgttcgc
tatttggcattccctcgccagggcatgaagcataagtctgctgaagagatgcaatctatt
tggtgtagtgcgacgccacagaaatcactggatgctgcgtttaaaggtaatgatatttcg
ccaattaaaggctgtaaggtgaatatcgctaaccattataaattggggctccagtttggc
gtgcagggaacgccggcgattatccttaaagatggcaacttattaggtggatatatgcca
ccagaagcgttggcaaagacattagatcagagtggtaaataa

DBGET integrated database retrieval system