KEGG   Photorhabdus asymbiotica: PAU_01412Help
Entry
PAU_01412         CDS       T00941                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00010  Glycolysis / Gluconeogenesis
pay00052  Galactose metabolism
pay00500  Starch and sucrose metabolism
pay00520  Amino sugar and nucleotide sugar metabolism
pay00521  Streptomycin biosynthesis
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01130  Biosynthesis of antibiotics
pay01200  Carbon metabolism
Module
pay_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pay_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAU_01412 (glk)
   00052 Galactose metabolism
    PAU_01412 (glk)
   00500 Starch and sucrose metabolism
    PAU_01412 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PAU_01412 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PAU_01412 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PAU_01412 (glk)
Enzymes [BR:pay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PAU_01412 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase DUF1653
Motif
Other DBs
NCBI-ProteinID: CAQ83504
UniProt: C7BSK1
Position
1601964..1602929
Genome map
AA seq 321 aa AA seqDB search
MNLYGLVADIGGTNARLALCNLKNGAIEQIETYNARQYAGLESIISHYLAEQKTVVTCAC
IAIACPISGDWVEMTNNQWAFSISELKQALKLEKLDVINDFTAVSMAIPMLTEEHKVQLG
GGKAVEDKPIAVYGAGTGLGVAHLIKVDKQWISLPGEGGHVDFAANSEEQDAILAVLRRK
LGHVSVERILSGSGLVNLYQAITILNHSQPEDLEPETVTQRALDESCQYCHRALSLFCEI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLDFFKQSNFLYGFEDKGRFKTLIQQIPVYLIT
HPQPGLLGSGTYLRQQLSLIA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaatctctatggactggtggctgatattggtggcacgaatgccagattagcactttgt
aatttgaaaaatggggctattgagcagattgaaacatataacgcaagacaatacgctgga
ttagagtctattattagccactatttggcggagcaaaaaacagtagtaacttgtgcttgt
atcgctattgcttgcccgatcagtggtgattgggttgaaatgactaataaccaatgggca
ttttctattagtgagctgaaacaggcgcttaagctagaaaaattagatgttattaatgat
ttcactgccgtctctatggctattccaatgttgacagaggaacataaagttcagttggga
ggggggaaggcggttgaagataaaccgattgctgtttatggagctggaactggccttgga
gtggctcatctgataaaagtggacaaacaatggataagtttgcctggtgagggtggtcat
gtggattttgcagcgaatagtgaagagcaagatgcaatattggctgttttgcgccgcaaa
ctgggccatgtttcggtcgaaagaatcttatctggtagtggactggtgaatctctatcag
gccattactattttgaatcatagtcagccggaagatttggaaccagaaacagtgacacag
cgagcgctggatgaaagttgccaatattgccatcgtgctctctcattattttgtgaaatc
atggggagatttggcggaaatttagcgttaaatctgggaacttttggtggtgtgtatatc
gctggtggtatagtgccacgatttcttgatttttttaagcagtcaaatttcttgtatggg
tttgaagataaagggcgctttaaaacattaatacaacagattcctgtttatttgattact
catccacaacctggattgctaggttcggggacatatttacggcaacagttatcgttgatt
gcctaa

DBGET integrated database retrieval system